Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Agouti related protein (AGRP) Antibody

Our Anti-Agouti related protein (AGRP) guinea pig polyclonal primary antibody detects human, mouse, rat, and sheep Agouti related protein (AGRP), and is whole serum. It is validated for use in IHC-Frozen.

Product Specifications

Product Name Alternative

Agrp; Agrt; Art; Agouti-related protein

UniProt

P56473

Reactivity

Human, Mouse, Rat, Sheep

Immunogen

A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.

Target

Agouti related protein (AGRP)

Clonality

Polyclonal

Conjugation

Unconjugated

Dilution

IHC: 1:1000-1:2000

Form

Lyophilized

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

IHC, frozen, PFA fixed material. Not yet tested on paraffin embedded tissue sections. A concentration of 1:1000 to 1:2000 is recommended for IHC with overnight incubations. Permeabilization suggested is 0.1% triton X-100 in blocking buffer. IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells and terminals. No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/mL of AGRP. In rodents such as rat cell terminal staining is most typically observed without cell body staining. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.

Tested Applications

IHC

Host or Source

Guinea pig

Isotype

Mixed

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Syndecan 4 ELISA Kit
MBS024343-01 48 Well

Mouse Syndecan 4 ELISA Kit

Sign In for Pricing
View Details
Mouse Syndecan 4 ELISA Kit
MBS024343-02 96 Well

Mouse Syndecan 4 ELISA Kit

Sign In for Pricing
View Details
Mouse Syndecan 4 ELISA Kit
MBS024343-03 5x 96 Well

Mouse Syndecan 4 ELISA Kit

Sign In for Pricing
View Details
Mouse Syndecan 4 ELISA Kit
MBS024343-04 10x 96 Well

Mouse Syndecan 4 ELISA Kit

Sign In for Pricing
View Details
SLC16A1 antibody
38537-01 50 µL

SLC16A1 antibody

Sign In for Pricing
View Details
SLC16A1 antibody
38537-02 100 µL

SLC16A1 antibody

Sign In for Pricing
View Details