Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLM9/CD300g, Rat (HEK293, His)

The CLM9/CD300g protein is known as a receptor and is thought to be involved in mediating L-selectin-dependent lymphocyte rolling. This protein exhibits calcium-dependent binding to SELL (L-selectin ligand), indicating its ability to interact with lymphocytes and potentially influence lymphocyte-related processes. CLM9/CD300g Protein, Rat (HEK293, His) is the recombinant rat-derived CLM9/CD300g protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CLM9/CD300g Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clm9-cd300g-protein-rat-hek293-his.html

Purity

98.00

Smiles

LTGPKEISGFEGDTVSLRCTYKKEMKVHRKYWCRQGGILLSRCGDTVYTNQDQEVTRGKMSIRDSLQDLWVTVTMRDLTLKDSGKYWCGIDRLGRDESFEVKLIVFPGSSRPVIWPPLTTPKDSRAVTSSVSKSSVSIPMVR

Molecular Formula

684984 (Gene_ID) XP_002724611.1 (L19-R160) (Accession)

Molecular Weight

Approximately 25-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tspan12 3'UTR Luciferase Stable Cell Line
TU121239 1.0 mL

Tspan12 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TLX2 Rabbit Polyclonal Antibody
orb158616-01 50 μL

TLX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TLX2 Rabbit Polyclonal Antibody
orb158616-02 100 µL

TLX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TLX2 Rabbit Polyclonal Antibody
orb158616-03 200 µL

TLX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Hydrazinobenzoic acid hydrochloride
sc-238065 25 g

2-Hydrazinobenzoic acid hydrochloride

Sign In for Pricing
View Details
SMAD6 (SMAD Family Member 6, HsT17432, MADH6, MADH7) (MaxLight 490)
MBS6208599-01 0.1 mL

SMAD6 (SMAD Family Member 6, HsT17432, MADH6, MADH7) (MaxLight 490)

Sign In for Pricing
View Details