Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Group XV phospholipase A2/Pla2g15, Mouse (His, myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/group-xv-phospholipase-a2-pla2g15-mouse-his-myc.html

Purity

90.00

Smiles

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Formula

192654 (Gene_ID) Q8VEB4 (A34-P412) (Accession)

Molecular Weight

Approximately 50.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ramp3 (NM_019511) Mouse Tagged ORF Clone
MR201003 10 µg

Ramp3 (NM_019511) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Monoclonal KLRB1 Antibody (monoclonal) (M01), Clone: 2F3
AMM03723G 0.1mg

Monoclonal KLRB1 Antibody (monoclonal) (M01), Clone: 2F3

Sign In for Pricing
View Details
Lentiviral human OSBPL3 shRNA (UAS) - Lentiviral human OSBPL3 shRNA (UAS, RFP) (100)
GTR15112212 1 Vial

Lentiviral human OSBPL3 shRNA (UAS) - Lentiviral human OSBPL3 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Granuphilin discontinued
343647-01 100 µL

Granuphilin discontinued

Sign In for Pricing
View Details
Granuphilin discontinued
343647-02 200 µL

Granuphilin discontinued

Sign In for Pricing
View Details
Nucleolar Protein, 30kD, Human, Control Peptide (NO30, Nop30)
N6939-68A 1 mg

Nucleolar Protein, 30kD, Human, Control Peptide (NO30, Nop30)

Sign In for Pricing
View Details