Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Group XV phospholipase A2/Pla2g15, Mouse (His, myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/group-xv-phospholipase-a2-pla2g15-mouse-his-myc.html

Purity

90.00

Smiles

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Formula

192654 (Gene_ID) Q8VEB4 (A34-P412) (Accession)

Molecular Weight

Approximately 50.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rps12 Rat siRNA Oligo Duplex (Locus ID 65139)
SR506614 1 Kit

Rps12 Rat siRNA Oligo Duplex (Locus ID 65139)

Sign In for Pricing
View Details
BCKDK, Human (sf9, GST)
HY-P702948-01 100 µg

BCKDK, Human (sf9, GST)

Sign In for Pricing
View Details
BCKDK, Human (sf9, GST)
HY-P702948-02 20 µg

BCKDK, Human (sf9, GST)

Sign In for Pricing
View Details
Rat PMN antibody (FITC)
60R-PR003ft 2 mg

Rat PMN antibody (FITC)

Sign In for Pricing
View Details
MGP Antibody
GWB-MS209B 50 µg

MGP Antibody

Sign In for Pricing
View Details
GBX1, ID (GBX1, Homeobox protein GBX-1, Gastrulation and brain-specific homeobox protein 1) (PE)
MBS6301532-01 0.2 mL

GBX1, ID (GBX1, Homeobox protein GBX-1, Gastrulation and brain-specific homeobox protein 1) (PE)

Sign In for Pricing
View Details