Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Group XV phospholipase A2/Pla2g15, Mouse (His, myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/group-xv-phospholipase-a2-pla2g15-mouse-his-myc.html

Purity

90.00

Smiles

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Formula

192654 (Gene_ID) Q8VEB4 (A34-P412) (Accession)

Molecular Weight

Approximately 50.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPLX1 (NM_006651) Human Over-expression Lysate
LY416506 100 µg

CPLX1 (NM_006651) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal MGA Antibody [DyLight 405]
NBP2-98097V 0.1 mL

Rabbit Polyclonal MGA Antibody [DyLight 405]

Sign In for Pricing
View Details
Lentiviral human CCDC81 sgRNA gene knockout kit - Lentiviral human CCDC81 sgRNA gene knockout kit (100)
GTR15378016 1 Vial

Lentiviral human CCDC81 sgRNA gene knockout kit - Lentiviral human CCDC81 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Human High temperature requirement protein A 2 (HtrA2/Omi) ELISA Kit
MBS9311633-01 48 Well

Human High temperature requirement protein A 2 (HtrA2/Omi) ELISA Kit

Sign In for Pricing
View Details
Human High temperature requirement protein A 2 (HtrA2/Omi) ELISA Kit
MBS9311633-02 96 Well

Human High temperature requirement protein A 2 (HtrA2/Omi) ELISA Kit

Sign In for Pricing
View Details
Human High temperature requirement protein A 2 (HtrA2/Omi) ELISA Kit
MBS9311633-03 5x 96 Well

Human High temperature requirement protein A 2 (HtrA2/Omi) ELISA Kit

Sign In for Pricing
View Details