Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Group XV phospholipase A2/Pla2g15, Mouse (His, myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/group-xv-phospholipase-a2-pla2g15-mouse-his-myc.html

Purity

90.00

Smiles

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Formula

192654 (Gene_ID) Q8VEB4 (A34-P412) (Accession)

Molecular Weight

Approximately 50.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCRN1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2104605 3x 1.0 µg

SCRN1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Hsd3b3 Recombinant Protein (Mouse)
RP142514 100 µg

Hsd3b3 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Lenercept (Reference antibody)
E55B1162 100 µg

Lenercept (Reference antibody)

Sign In for Pricing
View Details
SETP2 siRNA Oligos set (Human)
43546171 3x 5 nmol

SETP2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Recombinant E.coli DNA replication and repair protein RecF Protein, His-SUMO, E.coli-200ug
QP7319-ec-200ug 200ug

Recombinant E.coli DNA replication and repair protein RecF Protein, His-SUMO, E.coli-200ug

Sign In for Pricing
View Details
Lentiviral mouse Ddx55 shRNA (UAS) - Lentiviral mouse Ddx55 shRNA (UAS, GFP) plasmid
GTR15230710 1 Vial

Lentiviral mouse Ddx55 shRNA (UAS) - Lentiviral mouse Ddx55 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details