Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Group XV phospholipase A2/Pla2g15, Mouse (His, myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/group-xv-phospholipase-a2-pla2g15-mouse-his-myc.html

Purity

90.00

Smiles

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Formula

192654 (Gene_ID) Q8VEB4 (A34-P412) (Accession)

Molecular Weight

Approximately 50.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Raf-B Polyclonal Antibody
UB-GEN-14737 100 µL

Raf-B Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Putative uncharacterized protein WWC2-AS2 (WWC2-AS2)
MBS1398631-01 0.02 mg (E-Coli)

Recombinant Human Putative uncharacterized protein WWC2-AS2 (WWC2-AS2)

Sign In for Pricing
View Details
Recombinant Human Putative uncharacterized protein WWC2-AS2 (WWC2-AS2)
MBS1398631-02 0.1 mg (E-Coli)

Recombinant Human Putative uncharacterized protein WWC2-AS2 (WWC2-AS2)

Sign In for Pricing
View Details
Recombinant Human Putative uncharacterized protein WWC2-AS2 (WWC2-AS2)
MBS1398631-03 0.02 mg (Yeast)

Recombinant Human Putative uncharacterized protein WWC2-AS2 (WWC2-AS2)

Sign In for Pricing
View Details
Recombinant Human Putative uncharacterized protein WWC2-AS2 (WWC2-AS2)
MBS1398631-04 0.1 mg (Yeast)

Recombinant Human Putative uncharacterized protein WWC2-AS2 (WWC2-AS2)

Sign In for Pricing
View Details
Recombinant Human Putative uncharacterized protein WWC2-AS2 (WWC2-AS2)
MBS1398631-05 0.02 mg (Baculovirus)

Recombinant Human Putative uncharacterized protein WWC2-AS2 (WWC2-AS2)

Sign In for Pricing
View Details