Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Group XV phospholipase A2/Pla2g15, Mouse (His, myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/group-xv-phospholipase-a2-pla2g15-mouse-his-myc.html

Purity

90.00

Smiles

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Formula

192654 (Gene_ID) Q8VEB4 (A34-P412) (Accession)

Molecular Weight

Approximately 50.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMAN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1220507 1.0 µg DNA

LMAN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Interleukin-6 Soluable Receptor (IL-6SR) (Western Blot Control)
MBS343078-01 0.01 mg

Interleukin-6 Soluable Receptor (IL-6SR) (Western Blot Control)

Sign In for Pricing
View Details
Interleukin-6 Soluable Receptor (IL-6SR) (Western Blot Control)
MBS343078-02 5x 0.01 mg

Interleukin-6 Soluable Receptor (IL-6SR) (Western Blot Control)

Sign In for Pricing
View Details
Mouse Monoclonal Ndufs4 Antibody (1A1)
H00004724-M01 0.1 mg

Mouse Monoclonal Ndufs4 Antibody (1A1)

Sign In for Pricing
View Details
Mouse TRPM8 siRNA
abx938236-01 15 nmol

Mouse TRPM8 siRNA

Sign In for Pricing
View Details
Mouse TRPM8 siRNA
abx938236-02 30 nmol

Mouse TRPM8 siRNA

Sign In for Pricing
View Details