Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Group XV phospholipase A2/Pla2g15, Mouse (His, myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/group-xv-phospholipase-a2-pla2g15-mouse-his-myc.html

Purity

90.00

Smiles

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Formula

192654 (Gene_ID) Q8VEB4 (A34-P412) (Accession)

Molecular Weight

Approximately 50.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human HYDIN shRNA (UAS) - Lentiviral human HYDIN shRNA (UAS, RFP) (25)
GTR15348962 1 Vial

Lentiviral human HYDIN shRNA (UAS) - Lentiviral human HYDIN shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Human PDE1B shRNA Plasmid
abx953433-01 150 µg

Human PDE1B shRNA Plasmid

Sign In for Pricing
View Details
Human PDE1B shRNA Plasmid
abx953433-02 300 µg

Human PDE1B shRNA Plasmid

Sign In for Pricing
View Details
Anti-TACC3 Antibody (5C664)
MF-0090257-01 50 µL

Anti-TACC3 Antibody (5C664)

Sign In for Pricing
View Details
Anti-TACC3 Antibody (5C664)
MF-0090257-02 100 µL

Anti-TACC3 Antibody (5C664)

Sign In for Pricing
View Details
Rabbit Monoclonal TNF RII/TNFRSF1B Antibody (112) [Biotin]
NBP2-90434B 0.1 mL

Rabbit Monoclonal TNF RII/TNFRSF1B Antibody (112) [Biotin]

Sign In for Pricing
View Details