Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Group XV phospholipase A2/Pla2g15, Mouse (His, myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/group-xv-phospholipase-a2-pla2g15-mouse-his-myc.html

Purity

90.00

Smiles

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Formula

192654 (Gene_ID) Q8VEB4 (A34-P412) (Accession)

Molecular Weight

Approximately 50.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Mouse CD31 Antibody[390]
E-AB-F1180H-01 50 Tests

PE/Cyanine7 Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD31 Antibody[390]
E-AB-F1180H-02 100 Tests

PE/Cyanine7 Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD31 Antibody[390]
E-AB-F1180H-03 2x 100 Tests

PE/Cyanine7 Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details
Slc16a8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
43904116 3x 1.0 µg

Slc16a8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
TMPRSS5 Protein Vector (Mouse) (pPB-C-His)
PV240114 500 ng

TMPRSS5 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
IRX3 (IRXB1, Iroquois-class Homeodomain Protein IRX-3, Homeodomain Protein IRXB1, Iroquois Homeobox Protein 3, FLJ99187) (AP)
MBS6383113-01 0.1 mL

IRX3 (IRXB1, Iroquois-class Homeodomain Protein IRX-3, Homeodomain Protein IRXB1, Iroquois Homeobox Protein 3, FLJ99187) (AP)

Sign In for Pricing
View Details