Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Group XV phospholipase A2/Pla2g15, Mouse (His, myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/group-xv-phospholipase-a2-pla2g15-mouse-his-myc.html

Purity

90.00

Smiles

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Formula

192654 (Gene_ID) Q8VEB4 (A34-P412) (Accession)

Molecular Weight

Approximately 50.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Pxn (NM_133915) AAV Particle
MR227462A1V 250 µL

Mouse Pxn (NM_133915) AAV Particle

Sign In for Pricing
View Details
OR13C4 Antibody
ABD5012 100 µg

OR13C4 Antibody

Sign In for Pricing
View Details
Klk1b5 Mouse qPCR Template Standard (NM_008456)
MK200702 1 Kit

Klk1b5 Mouse qPCR Template Standard (NM_008456)

Sign In for Pricing
View Details
Toxoplasma gondii discontinued
T8076-10J 1 mg

Toxoplasma gondii discontinued

Sign In for Pricing
View Details
Recombinant Desulfococcus oleovorans ATP synthase subunit b 1 (atpF1)
MBS7009906-01 0.02 mg

Recombinant Desulfococcus oleovorans ATP synthase subunit b 1 (atpF1)

Sign In for Pricing
View Details
Recombinant Desulfococcus oleovorans ATP synthase subunit b 1 (atpF1)
MBS7009906-02 0.1 mg

Recombinant Desulfococcus oleovorans ATP synthase subunit b 1 (atpF1)

Sign In for Pricing
View Details