Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Group XV phospholipase A2/Pla2g15, Mouse (His, myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/group-xv-phospholipase-a2-pla2g15-mouse-his-myc.html

Purity

90.00

Smiles

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Formula

192654 (Gene_ID) Q8VEB4 (A34-P412) (Accession)

Molecular Weight

Approximately 50.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Drosophila melanogaster Putative gustatory receptor 59d (Gr59d)
MBS7016331-01 0.02 mg

Recombinant Drosophila melanogaster Putative gustatory receptor 59d (Gr59d)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Putative gustatory receptor 59d (Gr59d)
MBS7016331-02 0.1 mg

Recombinant Drosophila melanogaster Putative gustatory receptor 59d (Gr59d)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Putative gustatory receptor 59d (Gr59d)
MBS7016331-03 5x 0.1 mg

Recombinant Drosophila melanogaster Putative gustatory receptor 59d (Gr59d)

Sign In for Pricing
View Details
TRNAP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV753206 1.0 µg DNA

TRNAP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
GTPBP10 (NM_033107) Human Over-expression Lysate
LY409714 100 µg

GTPBP10 (NM_033107) Human Over-expression Lysate

Sign In for Pricing
View Details
AFMID (NM_001010982) Human Recombinant Protein
TP317126L 1 mg

AFMID (NM_001010982) Human Recombinant Protein

Sign In for Pricing
View Details