Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Group XV phospholipase A2/Pla2g15, Mouse (His, myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/group-xv-phospholipase-a2-pla2g15-mouse-his-myc.html

Purity

90.00

Smiles

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Formula

192654 (Gene_ID) Q8VEB4 (A34-P412) (Accession)

Molecular Weight

Approximately 50.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse monoclonal Apc11 Antibody (OTI3F5)
NBP2-45493 0.1 mL

Mouse monoclonal Apc11 Antibody (OTI3F5)

Sign In for Pricing
View Details
anti-PNLIPRP1
YF-PA13851 50 ug

anti-PNLIPRP1

Sign In for Pricing
View Details
0HSD17B7 Antibody
MBS9400673-01 0.1 mL

0HSD17B7 Antibody

Sign In for Pricing
View Details
0HSD17B7 Antibody
MBS9400673-02 5x 0.1 mL

0HSD17B7 Antibody

Sign In for Pricing
View Details
Human TGM3 (Transglutaminase 3, Epidermal) CLIA Kit
MBS2532520-01 96 Tests

Human TGM3 (Transglutaminase 3, Epidermal) CLIA Kit

Sign In for Pricing
View Details
Human TGM3 (Transglutaminase 3, Epidermal) CLIA Kit
MBS2532520-02 5x 96 Tests

Human TGM3 (Transglutaminase 3, Epidermal) CLIA Kit

Sign In for Pricing
View Details