Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Group XV phospholipase A2/Pla2g15, Mouse (His, myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/group-xv-phospholipase-a2-pla2g15-mouse-his-myc.html

Purity

90.00

Smiles

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Formula

192654 (Gene_ID) Q8VEB4 (A34-P412) (Accession)

Molecular Weight

Approximately 50.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3, CHN, CSMF, MINOR, NOR1, TEC) (MaxLight 650)
249483-ML650 100 µL

NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3, CHN, CSMF, MINOR, NOR1, TEC) (MaxLight 650)

Sign In for Pricing
View Details
Lentiviral human WFDC10A sgRNA gene knockout kit - Lentiviral human WFDC10A sgRNA gene knockout kit (25)
GTR15359280 1 Vial

Lentiviral human WFDC10A sgRNA gene knockout kit - Lentiviral human WFDC10A sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Mouse Sh2b3 activation kit by CRISPRa
GA202480 1 Kit

Mouse Sh2b3 activation kit by CRISPRa

Sign In for Pricing
View Details
Klrc1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6832006 1.0 µg DNA

Klrc1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
MSK1 (RPS6KA5) (NM_182398) Human Recombinant Protein
TP300549L 1 mg

MSK1 (RPS6KA5) (NM_182398) Human Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human VPS28 shRNA (UAS) - Lentiviral human VPS28 shRNA (UAS) (100)
GTR15134910 1 Vial

Lentiviral human VPS28 shRNA (UAS) - Lentiviral human VPS28 shRNA (UAS) (100)

Sign In for Pricing
View Details