Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Group XV phospholipase A2/Pla2g15, Mouse (His, myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/group-xv-phospholipase-a2-pla2g15-mouse-his-myc.html

Purity

90.00

Smiles

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Formula

192654 (Gene_ID) Q8VEB4 (A34-P412) (Accession)

Molecular Weight

Approximately 50.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKG2 (Phospho-Ser126) Antibody
MBS9416617-01 0.05 mL

PKG2 (Phospho-Ser126) Antibody

Sign In for Pricing
View Details
PKG2 (Phospho-Ser126) Antibody
MBS9416617-02 0.1 mL

PKG2 (Phospho-Ser126) Antibody

Sign In for Pricing
View Details
PKG2 (Phospho-Ser126) Antibody
MBS9416617-03 5x 0.1 mL

PKG2 (Phospho-Ser126) Antibody

Sign In for Pricing
View Details
Gabrg3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7006206 1.0 µg DNA

Gabrg3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Bcl2l15 Rat shRNA Plasmid (Locus ID 295337)
TL705039 1 Kit

Bcl2l15 Rat shRNA Plasmid (Locus ID 295337)

Sign In for Pricing
View Details
TRHR AAV siRNA Pooled Vector
47735161 1.0 µg

TRHR AAV siRNA Pooled Vector

Sign In for Pricing
View Details