Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Group XV phospholipase A2/Pla2g15, Mouse (His, myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/group-xv-phospholipase-a2-pla2g15-mouse-his-myc.html

Purity

90.00

Smiles

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Formula

192654 (Gene_ID) Q8VEB4 (A34-P412) (Accession)

Molecular Weight

Approximately 50.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HTR1F Blocking Peptide (Center)
MBS9229794-01 0.5 mg

HTR1F Blocking Peptide (Center)

Sign In for Pricing
View Details
HTR1F Blocking Peptide (Center)
MBS9229794-02 5x 0.5 mg

HTR1F Blocking Peptide (Center)

Sign In for Pricing
View Details
DPPA2 Rabbit Polyclonal Antibody
TA375602 100 µL

DPPA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
[2,3,5,6-Tetrafluoro-4- (trifluoromethyl) phenyl]hydrazine
420002-01 2.5 g

[2,3,5,6-Tetrafluoro-4- (trifluoromethyl) phenyl]hydrazine

Sign In for Pricing
View Details
[2,3,5,6-Tetrafluoro-4- (trifluoromethyl) phenyl]hydrazine
420002-02 5 g

[2,3,5,6-Tetrafluoro-4- (trifluoromethyl) phenyl]hydrazine

Sign In for Pricing
View Details
VEGFD (Vascular Endothelial Growth Factor D, VEGF-D, c-Fos-induced Growth Factor, FIGF, FIGF) (HRP)
V2121-31A-HRP 100 µL

VEGFD (Vascular Endothelial Growth Factor D, VEGF-D, c-Fos-induced Growth Factor, FIGF, FIGF) (HRP)

Sign In for Pricing
View Details