Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Group XV phospholipase A2/Pla2g15, Mouse (His, myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/group-xv-phospholipase-a2-pla2g15-mouse-his-myc.html

Purity

90.00

Smiles

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Formula

192654 (Gene_ID) Q8VEB4 (A34-P412) (Accession)

Molecular Weight

Approximately 50.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRTC1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV654042 1.0 µg DNA

CRTC1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Human TIMM8A Recombinant Protein (N-GST & C-His)
HT456022-01 50 µg

Human TIMM8A Recombinant Protein (N-GST & C-His)

Sign In for Pricing
View Details
Human TIMM8A Recombinant Protein (N-GST & C-His)
HT456022-02 100 µg

Human TIMM8A Recombinant Protein (N-GST & C-His)

Sign In for Pricing
View Details
Human TIMM8A Recombinant Protein (N-GST & C-His)
HT456022-03 1 mg

Human TIMM8A Recombinant Protein (N-GST & C-His)

Sign In for Pricing
View Details
Bestrophin 3 (BEST3) (NM_032735) Human Tagged ORF Clone Lentiviral Particle
RC216701L4V 200 µL

Bestrophin 3 (BEST3) (NM_032735) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LPCAT2 Peptide
DF3738-BP 1 mg

LPCAT2 Peptide

Sign In for Pricing
View Details