Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Group XV phospholipase A2/Pla2g15, Mouse (His, myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/group-xv-phospholipase-a2-pla2g15-mouse-his-myc.html

Purity

90.00

Smiles

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Formula

192654 (Gene_ID) Q8VEB4 (A34-P412) (Accession)

Molecular Weight

Approximately 50.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNPH Recombinant Rabbit mAb
E43S45759 100 µL

SNPH Recombinant Rabbit mAb

Sign In for Pricing
View Details
Awat2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3639804 1.0 µg DNA

Awat2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Rabbit Anti-TGF Beta 1+2+3 antibody
SL4538R-01 50 µL

Rabbit Anti-TGF Beta 1+2+3 antibody

Sign In for Pricing
View Details
Rabbit Anti-TGF Beta 1+2+3 antibody
SL4538R-02 100 µL

Rabbit Anti-TGF Beta 1+2+3 antibody

Sign In for Pricing
View Details
Cytochrome P450 17A1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-54306R-BF350 100 µL

Cytochrome P450 17A1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
DAN Domain Family Member 5 (DAND5) Antibody (HRP)
abx310099-01 20 µg

DAN Domain Family Member 5 (DAND5) Antibody (HRP)

Sign In for Pricing
View Details