Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Group XV phospholipase A2/Pla2g15, Mouse (His, myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/group-xv-phospholipase-a2-pla2g15-mouse-his-myc.html

Purity

90.00

Smiles

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Formula

192654 (Gene_ID) Q8VEB4 (A34-P412) (Accession)

Molecular Weight

Approximately 50.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE4D polyclonal antibody
BS6687 50ul

PDE4D polyclonal antibody

Sign In for Pricing
View Details
Anti-DENND3 (Thr450) Antibody
p1030-450 100 µL

Anti-DENND3 (Thr450) Antibody

Sign In for Pricing
View Details
PPIL6 (NM_001111298) Human Tagged Lenti ORF Clone
RC225382L3 10 µg

PPIL6 (NM_001111298) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ABL1 Protein Vector (Human) (pPB-His-GST)
PV318991 500 ng

ABL1 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Rat Apolipoprotein B mRNA Editing Enzyme Catalytic Subunit 1 (APOBEC1) ELISA Kit
abx500481 96 Tests

Rat Apolipoprotein B mRNA Editing Enzyme Catalytic Subunit 1 (APOBEC1) ELISA Kit

Sign In for Pricing
View Details
Metyrosine
318264 25.0mg

Metyrosine

Sign In for Pricing
View Details