Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Group XV phospholipase A2/Pla2g15, Mouse (His, myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/group-xv-phospholipase-a2-pla2g15-mouse-his-myc.html

Purity

90.00

Smiles

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Formula

192654 (Gene_ID) Q8VEB4 (A34-P412) (Accession)

Molecular Weight

Approximately 50.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Mouse Fatty Acid Binding Protein 4 (FABP4) ELISA
KLM1050 1x 96 Well

GENLISA™ Mouse Fatty Acid Binding Protein 4 (FABP4) ELISA

Sign In for Pricing
View Details
NNT1 (CLCF1) (NM_001166212) Human Over-expression Lysate
LC431793 20 µg

NNT1 (CLCF1) (NM_001166212) Human Over-expression Lysate

Sign In for Pricing
View Details
FBXW4, CT (FBXW4, FBW4, SHFM3, F-box/WD repeat-containing protein 4, Dactylin, F-box and WD-40 domain-containing protein 4) (Azide free) (HRP) discontinued
035572-HRP 200 µL

FBXW4, CT (FBXW4, FBW4, SHFM3, F-box/WD repeat-containing protein 4, Dactylin, F-box and WD-40 domain-containing protein 4) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Goat Calpain small subunit 1 (CAPNS1) ELISA Kit
MBS7215862-01 48 Well

Goat Calpain small subunit 1 (CAPNS1) ELISA Kit

Sign In for Pricing
View Details
Goat Calpain small subunit 1 (CAPNS1) ELISA Kit
MBS7215862-02 96 Well

Goat Calpain small subunit 1 (CAPNS1) ELISA Kit

Sign In for Pricing
View Details
Goat Calpain small subunit 1 (CAPNS1) ELISA Kit
MBS7215862-03 5x 96 Well

Goat Calpain small subunit 1 (CAPNS1) ELISA Kit

Sign In for Pricing
View Details