Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Group XV phospholipase A2/Pla2g15, Mouse (His, myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/group-xv-phospholipase-a2-pla2g15-mouse-his-myc.html

Purity

90.00

Smiles

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Formula

192654 (Gene_ID) Q8VEB4 (A34-P412) (Accession)

Molecular Weight

Approximately 50.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Murashige and Skoog (MS) Basal Medium, w/ Vitamins
30630067-5 1 Kg

Murashige and Skoog (MS) Basal Medium, w/ Vitamins

Sign In for Pricing
View Details
Med22 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6615907 1.0 µg DNA

Med22 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Anti-Noggin antibody
PAab05782 100 µg

Anti-Noggin antibody

Sign In for Pricing
View Details
Human SAR1A Pre-designed siRNA Set B
SI014278B 1 Each

Human SAR1A Pre-designed siRNA Set B

Sign In for Pricing
View Details
PDHX Knockout A549 Polyclonal Cells
ARG10835 1 Million

PDHX Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
Nerve Growth Factor, beta, , Recombinant, Rat, aa122-241 (NGFB, beta-NGF, Nerve Growth Factor, 2.5S NGF)
145718 25 µg

Nerve Growth Factor, beta, , Recombinant, Rat, aa122-241 (NGFB, beta-NGF, Nerve Growth Factor, 2.5S NGF)

Sign In for Pricing
View Details