Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADSL/Adenylosuccinate Lyase, Human (His)

ADSL/Adenylosuccinate Lyase Protein catalyzes two non-sequential steps in de novo AMP synthesis. It converts SAICAR to fumarate and 5-amino-1- (5-phospho-D-ribosyl) imidazole-4-carboxamide, contributing to de novo IMP synthesis. Additionally, it converts succinyladenosine monophosphate (SAMP) to AMP and fumarate. ADSL/Adenylosuccinate Lyase Protein, Human (His) is the recombinant human-derived ADSL/Adenylosuccinate Lyase protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ADSL/Adenylosuccinate Lyase Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adsl-adenylosuccinate-lyase-protein-human-his.html

Purity

95.00

Smiles

MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKVKAELCL

Molecular Formula

158 (Gene_ID) P30566-1 (M1-L484) (Accession)

Molecular Weight

Approximately 56 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Fc Region Of Immunoglobulin G, Fcγ Elisa Kit
EKC31222 96 Tests

Human Fc Region Of Immunoglobulin G, Fcγ Elisa Kit

Sign In for Pricing
View Details
Goose Lymphocyte Antigen 6C1 (LY6C1) ELISA Kit
MBS9367361 Inquire

Goose Lymphocyte Antigen 6C1 (LY6C1) ELISA Kit

Sign In for Pricing
View Details
Human CHRNa3 ELISA Kit
E008281 1 Each

Human CHRNa3 ELISA Kit

Sign In for Pricing
View Details
CCD47 Antibody Blocking peptide
orb1444278 500 µg

CCD47 Antibody Blocking peptide

Sign In for Pricing
View Details
Piperidine-azetidine-Br
HY-176226 1 Each

Piperidine-azetidine-Br

Sign In for Pricing
View Details
Alnuctamab (Anti-BCMA & CD3)
C00894-1mg 1 mg

Alnuctamab (Anti-BCMA & CD3)

Sign In for Pricing
View Details