Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ephrin-B2/EFNB2, Mouse (HEK293, Fc)

Ephrin-B2/EFNB2 Protein is a transmembrane ligand for Eph receptors, mediating bidirectional signaling and binding to EPHA4, EPHA3, and EPHB4. It regulates cell adhesion, migration, heart morphogenesis, angiogenesis, and axon orientation. It also interacts with PDZRN3. Ephrin-B2/EFNB2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Ephrin-B2/EFNB2 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Ephrin-B2/EFNB2 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ephrin-b2-efnb2-protein-mouse-hek293-fc.html

Purity

98.0

Smiles

RSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNHGPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSEVALFA

Molecular Formula

13642 (Gene_ID) P52800/NP_034241.2 (R29-A232) (Accession)

Molecular Weight

55-63 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PHACTR1 activation kit by CRISPRa
GA116634 1 Kit

Human PHACTR1 activation kit by CRISPRa

Sign In for Pricing
View Details
Egln3 (BC022961) Mouse Tagged ORF Clone
MG200563 10 µg

Egln3 (BC022961) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Anti-GJA1
Y058501 100 µL

Anti-GJA1

Sign In for Pricing
View Details
ZDHHC16 Human Gene Knockout Kit (CRISPR)
KN400927 1 Kit

ZDHHC16 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Aquaporin 6 (AQP6) (NM_001652) Human Over-expression Lysate
LC419821 20 µg

Aquaporin 6 (AQP6) (NM_001652) Human Over-expression Lysate

Sign In for Pricing
View Details
Tyrosine Hydroxylase (TH) Human Gene Knockout Kit (CRISPR)
KN211218 1 Kit

Tyrosine Hydroxylase (TH) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details