Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD84/SLAMF5, Rhesus Macaque (HEK293, His)

CD84/SLAMF5 protein is a self-ligand receptor in the SLAM family that regulates the activities of various immune cells through homotypic or heterotypic cell-cell interactions. It fine-tunes its function based on the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD84/SLAMF5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD84/SLAMF5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd84-slamf5-protein-cynomolgus-rhesus-macaque-hek293-his.html

Purity

97.00

Smiles

KDSEIITVNGILGESVTFPVNIQEPQQVTNIAWTSKTSVAYVTPGDSEMAPIVAVTHRNYYERIHALGPKYDLVISDLRMEDAGDYKADINTQAEPYTTTKRYNLQVYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEEQELTYTCTAQNPVSNNSDSISARQLCADIAMGLR

Molecular Formula

/ (Gene_ID) F6QA53 (K22-R220) (Accession)

Molecular Weight

Approximately 35-50 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-500 1x 500 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-100 1x 100 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL
BNC940977-100 1x 100 µL

TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
BNC040391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-100 1x 100 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details