Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD84/SLAMF5, Rhesus Macaque (HEK293, His)

CD84/SLAMF5 protein is a self-ligand receptor in the SLAM family that regulates the activities of various immune cells through homotypic or heterotypic cell-cell interactions. It fine-tunes its function based on the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD84/SLAMF5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD84/SLAMF5 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd84-slamf5-protein-cynomolgus-rhesus-macaque-hek293-his.html

Purity

97.00

Smiles

KDSEIITVNGILGESVTFPVNIQEPQQVTNIAWTSKTSVAYVTPGDSEMAPIVAVTHRNYYERIHALGPKYDLVISDLRMEDAGDYKADINTQAEPYTTTKRYNLQVYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEEQELTYTCTAQNPVSNNSDSISARQLCADIAMGLR

Molecular Formula

/ (Gene_ID) F6QA53 (K22-R220) (Accession)

Molecular Weight

Approximately 35-50 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MATK Monoclonal Antibody
BT-MCA4533-01 50 µL

MATK Monoclonal Antibody

Sign In for Pricing
View Details
MATK Monoclonal Antibody
BT-MCA4533-02 100 µL

MATK Monoclonal Antibody

Sign In for Pricing
View Details
GSK1904529A
A1302-5.1 10 mM (in 1mL DMSO)

GSK1904529A

Sign In for Pricing
View Details
Cytokeratin 3 Ab BSA/Azide Free
MBS5317186-01 0.05 mg

Cytokeratin 3 Ab BSA/Azide Free

Sign In for Pricing
View Details
Cytokeratin 3 Ab BSA/Azide Free
MBS5317186-02 5x 0.05 mg

Cytokeratin 3 Ab BSA/Azide Free

Sign In for Pricing
View Details
IL-13 Receptor alpha 1 Antibody (YA1377, Rabbit)
HY-P81632 1 Each

IL-13 Receptor alpha 1 Antibody (YA1377, Rabbit)

Sign In for Pricing
View Details