Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Augurin (ECRG4), partial

Product Specifications

Product Name Alternative

(Esophageal cancer-related gene 4 protein) (ECRG4)

Abbreviation

Recombinant Human ECRG4 protein, partial

Gene Name

ECRG4

UniProt

Q9H1Z8

Expression Region

71-132aa

Organism

Homo sapiens (Human)

Target Sequence

QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Probable hormone that may attenuate cell proliferation and induce senescence of oligodendrocyte and neural precursor cells in the central nervous system. ECRG4-induced senescence is characterized by G1 arrest, RB1 dephosphorylation and accelerated CCND1 and CCND3 proteasomal degradation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

12.9 kDa

References & Citations

"Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K. Nature 434:724-731 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL27 Mouse Monoclonal Antibody [Clone ID: B-G49]
AM31269AF-N 500 µg

IL27 Mouse Monoclonal Antibody [Clone ID: B-G49]

Sign In for Pricing
View Details
DNA Ligase 1 (1A9), 1mg/mL
BNUM2177-50 1x 50 µL

DNA Ligase 1 (1A9), 1mg/mL

Sign In for Pricing
View Details
Dopamine D2 Receptor Recombinant Rabbit monoclonal Antibody
HA751324 100 µL

Dopamine D2 Receptor Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
MCPH1 Polyclonal Antibody
E-AB-52481-01 20 µL

MCPH1 Polyclonal Antibody

Sign In for Pricing
View Details
MCPH1 Polyclonal Antibody
E-AB-52481-02 60 µL

MCPH1 Polyclonal Antibody

Sign In for Pricing
View Details
MCPH1 Polyclonal Antibody
E-AB-52481-03 120 µL

MCPH1 Polyclonal Antibody

Sign In for Pricing
View Details