Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin, Mouse (HEK293, His)

Noggin is an indispensable factor in cartilage morphogenesis and joint formation, a potent inhibitor of bone morphogenetic protein (BMP) signaling, and plays a crucial role in the growth and patterning of the neural tube and somites.By forming homodimers, Noggin acts as a key regulator to inhibit chondrocyte differentiation by interacting with growth and differentiation factors, particularly GDF5 and possibly GDF6.Noggin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Noggin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Noggin Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/noggin-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Molecular Formula

18121 (Gene_ID) P97466 (Q28-C232) (Accession)

Molecular Weight

Approximately 30.0 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mcfd2 Mouse Pre-designed siRNA Set A
HY-RS21643 1 Set

Mcfd2 Mouse Pre-designed siRNA Set A

Ask
View Details
RhoG Blocking Peptide
CBP5025-01 1 mg

RhoG Blocking Peptide

Ask
View Details
RhoG Blocking Peptide
CBP5025-02 5 mg

RhoG Blocking Peptide

Ask
View Details
Cytochrome P450 26B (CYP26B1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A8]
TA811497AM 100 µL

Cytochrome P450 26B (CYP26B1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A8]

Ask
View Details
SHISA9 isoform X2 Antibody Western Blot Positive Control
MBS542638-01 5 Applications

SHISA9 isoform X2 Antibody Western Blot Positive Control

Ask
View Details
SHISA9 isoform X2 Antibody Western Blot Positive Control
MBS542638-02 5x 5 Applications

SHISA9 isoform X2 Antibody Western Blot Positive Control

Ask
View Details