Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin, Mouse (HEK293, His)

Noggin is an indispensable factor in cartilage morphogenesis and joint formation, a potent inhibitor of bone morphogenetic protein (BMP) signaling, and plays a crucial role in the growth and patterning of the neural tube and somites.By forming homodimers, Noggin acts as a key regulator to inhibit chondrocyte differentiation by interacting with growth and differentiation factors, particularly GDF5 and possibly GDF6.Noggin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Noggin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Noggin Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/noggin-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Molecular Formula

18121 (Gene_ID) P97466 (Q28-C232) (Accession)

Molecular Weight

Approximately 30.0 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

C1orf100 Human qPCR Primer Pair (NM_001012970)
HP202262 200 Reactions

C1orf100 Human qPCR Primer Pair (NM_001012970)

Ask
View Details
VEGF, Recombinant, Human, Animal Free (Vascular Endothelial Growth Factor121, VPF) discontinued
208711-01 2 µg

VEGF, Recombinant, Human, Animal Free (Vascular Endothelial Growth Factor121, VPF) discontinued

Ask
View Details
VEGF, Recombinant, Human, Animal Free (Vascular Endothelial Growth Factor121, VPF) discontinued
208711-02 10 µg

VEGF, Recombinant, Human, Animal Free (Vascular Endothelial Growth Factor121, VPF) discontinued

Ask
View Details
TRUB1 (NM_139169) Human Over-expression Lysate
LC408372 20 µg

TRUB1 (NM_139169) Human Over-expression Lysate

Ask
View Details
Human THSD7A (Thrombospondin, Type I, Domain Containing 7A) ELISA Kit
MBS7606098-01 48 Well

Human THSD7A (Thrombospondin, Type I, Domain Containing 7A) ELISA Kit

Ask
View Details
Human THSD7A (Thrombospondin, Type I, Domain Containing 7A) ELISA Kit
MBS7606098-02 96 Well

Human THSD7A (Thrombospondin, Type I, Domain Containing 7A) ELISA Kit

Ask
View Details