Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin, Mouse (HEK293, His)

Noggin is an indispensable factor in cartilage morphogenesis and joint formation, a potent inhibitor of bone morphogenetic protein (BMP) signaling, and plays a crucial role in the growth and patterning of the neural tube and somites.By forming homodimers, Noggin acts as a key regulator to inhibit chondrocyte differentiation by interacting with growth and differentiation factors, particularly GDF5 and possibly GDF6.Noggin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Noggin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Noggin Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/noggin-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Molecular Formula

18121 (Gene_ID) P97466 (Q28-C232) (Accession)

Molecular Weight

Approximately 30.0 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit anti-human Aspartyl/asparaginyl beta-hydroxylase polyclonal Antibody, Biotin conjugated
MBS1489140-01 0.05 mg

Rabbit anti-human Aspartyl/asparaginyl beta-hydroxylase polyclonal Antibody, Biotin conjugated

Ask
View Details
Rabbit anti-human Aspartyl/asparaginyl beta-hydroxylase polyclonal Antibody, Biotin conjugated
MBS1489140-02 0.1 mg

Rabbit anti-human Aspartyl/asparaginyl beta-hydroxylase polyclonal Antibody, Biotin conjugated

Ask
View Details
Rabbit anti-human Aspartyl/asparaginyl beta-hydroxylase polyclonal Antibody, Biotin conjugated
MBS1489140-03 5x 0.1 mg

Rabbit anti-human Aspartyl/asparaginyl beta-hydroxylase polyclonal Antibody, Biotin conjugated

Ask
View Details
GENLISA Rat SERPINA7 (Thyroxine-binding globulin) ELISA
KLR6541 1x 96 Well

GENLISA Rat SERPINA7 (Thyroxine-binding globulin) ELISA

Ask
View Details
TNFRSF12A (Tumor Necrosis Factor Receptor Superfamily Member 12A, CD266, Fibroblast Growth Factor-inducible Immediate-early Response Protein 14, FGF-inducible 14, FN14, Tweak-receptor, TweakR) (MaxLight 490)
MBS6203780-01 0.1 mL

TNFRSF12A (Tumor Necrosis Factor Receptor Superfamily Member 12A, CD266, Fibroblast Growth Factor-inducible Immediate-early Response Protein 14, FGF-inducible 14, FN14, Tweak-receptor, TweakR) (MaxLight 490)

Ask
View Details
TNFRSF12A (Tumor Necrosis Factor Receptor Superfamily Member 12A, CD266, Fibroblast Growth Factor-inducible Immediate-early Response Protein 14, FGF-inducible 14, FN14, Tweak-receptor, TweakR) (MaxLight 490)
MBS6203780-02 5x 0.1 mL

TNFRSF12A (Tumor Necrosis Factor Receptor Superfamily Member 12A, CD266, Fibroblast Growth Factor-inducible Immediate-early Response Protein 14, FGF-inducible 14, FN14, Tweak-receptor, TweakR) (MaxLight 490)

Ask
View Details