Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-8, Human (HEK293, His)

Frizzled-8 is a Wnt receptor that critically coordinates β-catenin signaling through the complex Wnt-Fzd-LRP5-LRP6 complex. It acts through the canonical Wnt/β-catenin pathway, activating scrambled proteins, inhibiting GSK-3 kinase, inducing nuclear β-catenin accumulation, and activating Wnt target genes. Frizzled-8 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-8 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Frizzled-8 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-8-protein-human-hek-293-his.html

Purity

95.0

Smiles

ASAKELACQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPP

Molecular Formula

8325 (Gene_ID) Q9H461 (A28-P172) (Accession)

Molecular Weight

22-32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p21 (CDKN1A) (NM_001220778) Human Untagged Clone
SC329916 10 µg

p21 (CDKN1A) (NM_001220778) Human Untagged Clone

Sign In for Pricing
View Details
Prostaglandin E Receptor EP4/PTGER4 Rabbit Polyclonal Antibody (Biotin)
orb2615765 100 µg

Prostaglandin E Receptor EP4/PTGER4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Nad+ Kinase (NADK) Activity Assay Kit
FY-BC4504 96 Tests

Nad+ Kinase (NADK) Activity Assay Kit

Sign In for Pricing
View Details
Gm13083 Protein Lysate (Mouse) with C-HA Tag
21780034 100 µg

Gm13083 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
SOX10 Western Blot kit (AWBK33326)
AWBK33326 10 Reactions

SOX10 Western Blot kit (AWBK33326)

Sign In for Pricing
View Details
Recombinant Rhizobium etli Chaperone protein DnaK (dnaK), partial
MBS1118920 Inquire

Recombinant Rhizobium etli Chaperone protein DnaK (dnaK), partial

Sign In for Pricing
View Details