Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-13, Human (His)

IL-13 Protein is a cytokine which is secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. IL-13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. Animal-Free IL-13 Protein, Human (His) is the recombinant human-derived animal-FreeIL-13 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-13 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-13-protein-human-his.html

Purity

95.0

Smiles

MGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) P35225 (G35-N146) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Rael EL, et al. Interleukin-13 signaling and its role in asthma. World Allergy Organ J. 2011 Mar;4 (3) :54-64.|[2]Minty A, et al. Interleukin-13 is a new human lymphokine regulating inflammatory and immune responses. Nature. 1993 Mar 18;362 (6417) :248-50.|[3]Miloux B, et al. Cloning of the human IL-13R alpha1 chain and reconstitution with the IL4R alpha of a functional IL-4/IL-13 receptor complex. FEBS Lett. 1997 Jan 20;401 (2-3) :163-6.|[4]Defrance T, et al. Interleukin 13 is a B cell stimulating factor. J Exp Med. 1994 Jan 1;179 (1) :135-43.|[5]Luttmann W, et al. Activation of human eosinophils by IL-13. Induction of CD69 surface antigen, its relationship to messenger RNA expression, and promotion of cellular viability. J Immunol. 1996 Aug 15;157 (4) :1678-83.|[6]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC22A16 Rabbit Polyclonal Antibody (Fluoro550)
orb3128585 100 µg

SLC22A16 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
CD1a (Cortical thymocyte antigen CD1A, Epidermal dendritic cell marker CD1a antibody, FCB6, HTA1, T cell surface antigen T6 / Leu 6, T-Cell Surface Glycoprotein CD1A)
168669-01 20 µg

CD1a (Cortical thymocyte antigen CD1A, Epidermal dendritic cell marker CD1a antibody, FCB6, HTA1, T cell surface antigen T6 / Leu 6, T-Cell Surface Glycoprotein CD1A)

Sign In for Pricing
View Details
CD1a (Cortical thymocyte antigen CD1A, Epidermal dendritic cell marker CD1a antibody, FCB6, HTA1, T cell surface antigen T6 / Leu 6, T-Cell Surface Glycoprotein CD1A)
168669-02 100 µg

CD1a (Cortical thymocyte antigen CD1A, Epidermal dendritic cell marker CD1a antibody, FCB6, HTA1, T cell surface antigen T6 / Leu 6, T-Cell Surface Glycoprotein CD1A)

Sign In for Pricing
View Details
FDPS (Farnesyl Pyrophosphate Synthase, FPP Synthase, FPS, Farnesyl Diphosphate Synthase, FPS, KIAA1293) (MaxLight 490)
126737-ML490 100 µL

FDPS (Farnesyl Pyrophosphate Synthase, FPP Synthase, FPS, Farnesyl Diphosphate Synthase, FPS, KIAA1293) (MaxLight 490)

Sign In for Pricing
View Details
Stat5b Double Nickase Plasmid (h)
sc-400878-NIC 20 µg

Stat5b Double Nickase Plasmid (h)

Sign In for Pricing
View Details
CYP2R1, ID (Vitamin D 25-hydroxylase, Cytochrome P450 2R1) (APC) discontinued
C9095-19G1-APC 200 µL

CYP2R1, ID (Vitamin D 25-hydroxylase, Cytochrome P450 2R1) (APC) discontinued

Sign In for Pricing
View Details