Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Measles virus Phosphoprotein (P/V), partial

Product Specifications

Product Name Alternative

(Protein P)

Abbreviation

Recombinant Measles virus Phosphoprotein, partial

Gene Name

P/V

UniProt

P03422

Expression Region

459-507aa

Organism

Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)

Target Sequence

ASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIMK

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Essential component of the RNA polymerase and the nascent chain assembly complex. Also required during RNA synthesis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.1 kDa

References & Citations

"Crystal structure of the measles virus phosphoprotein domain responsible for the induced folding of the C-terminal domain of the nucleoprotein." Johansson K., Bourhis J.M., Campanacci V., Cambillau C., Canard B., Longhi S. J Biol Chem 278:44567-44573 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human POU5F1B activation kit by CRISPRa
GA103683 1 Kit

Human POU5F1B activation kit by CRISPRa

Sign In for Pricing
View Details
Mini Pro 500V Power Supply
MINI-500 1 Unit

Mini Pro 500V Power Supply

Sign In for Pricing
View Details
NADK Antibody
KC-11065-01 50 μL

NADK Antibody

Sign In for Pricing
View Details
NADK Antibody
KC-11065-02 100 µL

NADK Antibody

Sign In for Pricing
View Details
NADK Antibody
KC-11065-03 1 mL

NADK Antibody

Sign In for Pricing
View Details
D aspartate oxidase (DDO) (NM_003649) Human Over-expression Lysate
LY401207 100 µg

D aspartate oxidase (DDO) (NM_003649) Human Over-expression Lysate

Sign In for Pricing
View Details