Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active)

Product Specifications

Abbreviation

Recombinant Rat Ly6g6d protein (Active)

Gene Name

Ly6g6d

UniProt

Q6MG58

Expression Region

20-108aa

Organism

Rattus norvegicus (Rat)

Target Sequence

QRMRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN

Tag

N-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein

Source

Yeast

Field of Research

Immunology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Rat Ly6g6d at 2 μg/mL can bind Anti-Ly6g6d recombinant antibody (CSB-RA013246MA4HU) . The EC50 is 6.238-7.258 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

11.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to Glycine Receptor Alpha 2 (GLRa2)
MBS2075684-01 0.1 mL

PE-Linked Polyclonal Antibody to Glycine Receptor Alpha 2 (GLRa2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Glycine Receptor Alpha 2 (GLRa2)
MBS2075684-02 0.2 mL

PE-Linked Polyclonal Antibody to Glycine Receptor Alpha 2 (GLRa2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Glycine Receptor Alpha 2 (GLRa2)
MBS2075684-03 0.5 mL

PE-Linked Polyclonal Antibody to Glycine Receptor Alpha 2 (GLRa2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Glycine Receptor Alpha 2 (GLRa2)
MBS2075684-04 1 mL

PE-Linked Polyclonal Antibody to Glycine Receptor Alpha 2 (GLRa2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Glycine Receptor Alpha 2 (GLRa2)
MBS2075684-05 5 mL

PE-Linked Polyclonal Antibody to Glycine Receptor Alpha 2 (GLRa2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Glycine Receptor Alpha 2 (GLRa2)
MBS2075684-06 5x 5 mL

PE-Linked Polyclonal Antibody to Glycine Receptor Alpha 2 (GLRa2)

Sign In for Pricing
View Details