Cathepsin L2, Human (HEK293, His)
Cathepsin L2 Protein, Human (HEK293, His) is a functional cysteine proteinase, mainly expressed in the cornea, testis, thymus, and epidermis.
Product Specifications
Product Name Alternative
Cathepsin L2 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cathepsin-l2-protein-human-hek293-his.html
Purity
95.0
Smiles
VPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNVHHHHHH
Molecular Formula
1515 (Gene_ID) O60911 (V18-V334) (Accession)
Molecular Weight
Approximately 35-39 kDa
References & Citations
[1]I Santamaría, et al. Cathepsin L2, a novel human cysteine proteinase produced by breast and colorectal carcinomas. Cancer Res. 1998 Apr 15;58 (8) :1624-30.|[2]Sascha Hagemann, et al. The human cysteine protease cathepsin V can compensate for murine cathepsin L in mouse epidermis and hair follicles. Eur J Cell Biol. 2004 Dec;83 (11-12) :775-80.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880029-100 1x 100 µL
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681081-100 1x 100 µL
CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680633-500 1x 500 µL
Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 