CD69, Mouse (HEK293, His)
CD69 Protein, a signal transmitting receptor, mediates lymphocyte proliferation in NK cells, platelets, and lymphocytes. It facilitates homodimer formation through disulfide-linkage. CD69 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD69 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
CD69 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd69-protein-mouse-hek293-his.html
Purity
97.0
Smiles
NVGKYNCPGLYEKLESSDHHVATCKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELEHWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCSKPSR
Molecular Formula
12515 (Gene_ID) P37217 (N62-R199) (Accession)
Molecular Weight
Approximately 24-32 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
TAPBP (NGS 17, NGS-17, NGS17, TAP Associated Protein, TAP Binding Protein, TAP Binding Protein (tapasin), TAP BP, TAP-Associated Protein, TAP-Binding Protein, TAPA, Tapasin, TAPBP, TPN, TPSN, TPSN_HUMAN, ) discontinued
TAPBP (NGS 17, NGS-17, NGS17, TAP Associated Protein, TAP Binding Protein, TAP Binding Protein (tapasin), TAP BP, TAP-Associated Protein, TAP-Binding Protein, TAPA, Tapasin, TAPBP, TPN, TPSN, TPSN_HUMAN, ) discontinued
