Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza B virus Nuclear export protein (NS)

Product Specifications

Product Name Alternative

NEP (Non-structural protein 2) (NS2)

Abbreviation

Recombinant Influenza B virus Nuclear export protein

Gene Name

NS

UniProt

P08014

Expression Region

1-122aa

Organism

Influenza B virus (strain B/Yamagata/1/1973)

Target Sequence

MADNMTTTQIEWRMKKMAIGSSTHSSSVLMKDIQSQFEQLKLRWESYPNLVKSTDYHQRRETIRLVTEELYLLSKRIDDNILFHKTVIANSSIIADMIVSLSLLETLYEMKDVVEVYSRQCL

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Mediates the nuclear export of encapsidated genomic RNAs . Acts as an adapter between viral RNPs complexes and the nuclear export machinery of the cell. Possesses no intrinsic RNA-binding activity, but includes a C-terminal M1-binding domain. This domain is believed to allow recognition of RNPs bound to the protein M1. Since protein M1 is not available in large quantities before late stages of infection, such an indirect recognition mechanism probably ensures that genomic RNPs are not exported from the host nucleus until sufficient quantities of viral mRNA and progeny genomic RNA have been synthesized. Furthermore, the RNPs enter the host cytoplasm only when associated with the M1 protein that is necessary to guide them to the plasma membrane. May down-regulate viral RNA synthesis when overproduced.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.4 kDa

References & Citations

"Infectious influenza A and B virus variants with long carboxyl terminal deletions in the NS1 polypeptides." Norton G.P., Tanaka T., Tobita K., Nakada S., Buonagurio D.A., Greenspan D., Krystal M., Palese P. Virology 156:204-213 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Gabbr1 Pre-designed siRNA Set A
SI105198A 1 Each

Mouse Gabbr1 Pre-designed siRNA Set A

Ask
View Details
M1/M4 muscarinic agonist 2
HY-149703 1 Each

M1/M4 muscarinic agonist 2

Ask
View Details
Rabbit anti-Caenorhabditis elegans csn-6 Polyclonal Antibody
MBS9005777 Inquire

Rabbit anti-Caenorhabditis elegans csn-6 Polyclonal Antibody

Ask
View Details
Biotin-Linked Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7)
MBS2006564-01 0.1 mL

Biotin-Linked Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7)

Ask
View Details
Biotin-Linked Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7)
MBS2006564-02 0.2 mL

Biotin-Linked Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7)

Ask
View Details
Biotin-Linked Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7)
MBS2006564-03 0.5 mL

Biotin-Linked Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7)

Ask
View Details