Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELAV like RNA binding protein 1 Antibody

Goat polyclonal antibody to ELAVL1. ELAVL1, also known as HuR (Human antigen R), is a ubiquitously expressed RNA-binding protein that plays a pivotal role in post-transcriptional regulation of gene expression. It belongs to the ELAV (embryonic lethal abnormal vision) family of proteins, which are characterized by their ability to bind to AU-rich elements (AREs) in the 3' untranslated regions (3' UTRs) of target mRNAs, thereby influencing mRNA stability and translation.

Product Specifications

Product Name Alternative

ELAV1, HUR, Hua and MelG antibody.

Reactivity

Canine, Human, Monkey, Mouse, Rat

Immunogen

Antigen: Purified recombinant peptide derived from within residues 271 aa to the C-terminus of human ELAVL1 produced in E. coli. . Antigen Sequence: MTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFKTNKSHK

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Signal Transduction

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:5,000

Form

Polyclonal antibody supplied as a 100 μl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

WB

Host or Source

Goat

Isotype

IgG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPATA18 siRNA (Human)
MBS8212574-01 15 nmol

SPATA18 siRNA (Human)

Sign In for Pricing
View Details
SPATA18 siRNA (Human)
MBS8212574-02 30 nmol

SPATA18 siRNA (Human)

Sign In for Pricing
View Details
SPATA18 siRNA (Human)
MBS8212574-03 5x 30 nmol

SPATA18 siRNA (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal LKB1/STK11 Antibody
NBP1-87817-25ul 25 µL

Rabbit Polyclonal LKB1/STK11 Antibody

Sign In for Pricing
View Details
GLRX (Glutaredoxin-1, GRX, GRX1) (MaxLight 750)
MBS6418607-01 0.1 mL

GLRX (Glutaredoxin-1, GRX, GRX1) (MaxLight 750)

Sign In for Pricing
View Details
GLRX (Glutaredoxin-1, GRX, GRX1) (MaxLight 750)
MBS6418607-02 5x 0.1 mL

GLRX (Glutaredoxin-1, GRX, GRX1) (MaxLight 750)

Sign In for Pricing
View Details