Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELAV like RNA binding protein 1 Antibody

Goat polyclonal antibody to ELAVL1. ELAVL1, also known as HuR (Human antigen R), is a ubiquitously expressed RNA-binding protein that plays a pivotal role in post-transcriptional regulation of gene expression. It belongs to the ELAV (embryonic lethal abnormal vision) family of proteins, which are characterized by their ability to bind to AU-rich elements (AREs) in the 3' untranslated regions (3' UTRs) of target mRNAs, thereby influencing mRNA stability and translation.

Product Specifications

Product Name Alternative

ELAV1, HUR, Hua and MelG antibody.

Reactivity

Canine, Human, Monkey, Mouse, Rat

Immunogen

Antigen: Purified recombinant peptide derived from within residues 271 aa to the C-terminus of human ELAVL1 produced in E. coli. . Antigen Sequence: MTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFKTNKSHK

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Signal Transduction

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:5,000

Form

Polyclonal antibody supplied as a 100 μl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

WB

Host or Source

Goat

Isotype

IgG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAAP100 qPCR Primer Pair
QH53289S 200 Tests

Human FAAP100 qPCR Primer Pair

Sign In for Pricing
View Details
STAU1 Antibody
orb1238880-01 0.02 mg

STAU1 Antibody

Sign In for Pricing
View Details
STAU1 Antibody
orb1238880-02 0.1 mg

STAU1 Antibody

Sign In for Pricing
View Details
RIC8B ORF Vector (Human) (pORF)
ORF014298 1.0 µg DNA

RIC8B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
dUTP, 100mM
BIO-39035 25µmol, (1 x 250µl)

dUTP, 100mM

Sign In for Pricing
View Details
TRADD Antibody (Center) Blocking peptide
MBS9218760-01 0.5 mg

TRADD Antibody (Center) Blocking peptide

Sign In for Pricing
View Details