Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (CHO)

IL-13 Protein, Human (CHO) is a CHO cell derived cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-114a-a-cho.html

Purity

95.00

Smiles

SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) P35225 (S33-N146) (Accession)

Molecular Weight

Approximately 10-25 kDa under reduced (R) conditions, 25-45 kDa under non reducing (N) conditions, based on SDS-PAGE, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBFb Rabbit Polyclonal Antibody (Fluoro594)
orb3115847 100 µg

CBFb Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
ULK1 Antibody
F47190-0.08ML 0.08 mL

ULK1 Antibody

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) HRR25 Polyclonal Antibody
MBS7158863 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) HRR25 Polyclonal Antibody

Sign In for Pricing
View Details
Bovine Acylphosphatase-1, ACYP1 ELISA KIT
ELI-24591b 96 Tests

Bovine Acylphosphatase-1, ACYP1 ELISA KIT

Sign In for Pricing
View Details
Mouse Monoclonal MCAM/CD146 Antibody (C146/634) [mFluor Violet 500 SE]
NBP3-11467MFV500 0.1 mL

Mouse Monoclonal MCAM/CD146 Antibody (C146/634) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
NOX3 siRNA (Mouse)
orb1836920-01 15 nmol

NOX3 siRNA (Mouse)

Sign In for Pricing
View Details