Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GM-CSF, Mouse (HEK293, Fc)

The GM-CSF protein acts as a potent cytokine that coordinates the growth and differentiation of hematopoietic precursor cells of different lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer and its signaling is mediated through a dodecamer complex. GM-CSF Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived GM-CSF protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

GM-CSF Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gm-csf-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

Molecular Formula

12981 (Gene_ID) P01587 (A18-K141) (Accession)

Molecular Weight

Approximately 45-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MAP3K13 ELISA Kit
ELI-39712h 96 Tests

Human MAP3K13 ELISA Kit

Sign In for Pricing
View Details
Recombinant Lactobacillus casei Xanthine phosphoribosyltransferase (xpt)
MBS1110752-01 0.02 mg (E-Coli)

Recombinant Lactobacillus casei Xanthine phosphoribosyltransferase (xpt)

Sign In for Pricing
View Details
Recombinant Lactobacillus casei Xanthine phosphoribosyltransferase (xpt)
MBS1110752-02 0.1 mg (E-Coli)

Recombinant Lactobacillus casei Xanthine phosphoribosyltransferase (xpt)

Sign In for Pricing
View Details
Recombinant Lactobacillus casei Xanthine phosphoribosyltransferase (xpt)
MBS1110752-03 0.02 mg (Yeast)

Recombinant Lactobacillus casei Xanthine phosphoribosyltransferase (xpt)

Sign In for Pricing
View Details
Recombinant Lactobacillus casei Xanthine phosphoribosyltransferase (xpt)
MBS1110752-04 0.1 mg (Yeast)

Recombinant Lactobacillus casei Xanthine phosphoribosyltransferase (xpt)

Sign In for Pricing
View Details
Recombinant Lactobacillus casei Xanthine phosphoribosyltransferase (xpt)
MBS1110752-05 0.02 mg (Baculovirus)

Recombinant Lactobacillus casei Xanthine phosphoribosyltransferase (xpt)

Sign In for Pricing
View Details