Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YebF, E.coli (Myc, His)

YebF protein, existing as a monomer in solution, interacts with OmpF/OmpC at the periplasmic face of the membrane, indicating a role in bacterial membrane-related processes. Its monomeric state emphasizes independent structure, prompting further investigation into the molecular mechanisms and functional impact of its interactions with OmpF/OmpC in the bacterial membrane. YebF Protein, E.coli (Myc, His) is the recombinant E. coli-derived YebF protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

YebF Protein, E.coli (Myc, His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/yebf-protein-e-coli-myc-his.html

Smiles

ANNETSKSVTFPKCEDLDAAGIAASVKRDYQQNRVARWADDQKIVGQADPVAWVSLQDIQGKDDKWSVPLTVRGKSADIHYQVSVDCKAGMAEYQRR

Molecular Formula

946363 (Gene_ID) P33219 (A22-R118) (Accession)

Molecular Weight

Approximately 15.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human Interleukin-1 alpha protein (IL1A)
MBS9423059-01 0.01 mg

Recombinant Human Interleukin-1 alpha protein (IL1A)

Ask
View Details
Recombinant Human Interleukin-1 alpha protein (IL1A)
MBS9423059-02 0.1 mg

Recombinant Human Interleukin-1 alpha protein (IL1A)

Ask
View Details
Recombinant Human Interleukin-1 alpha protein (IL1A)
MBS9423059-03 0.25 mg

Recombinant Human Interleukin-1 alpha protein (IL1A)

Ask
View Details
Recombinant Human Interleukin-1 alpha protein (IL1A)
MBS9423059-04 0.5 mg

Recombinant Human Interleukin-1 alpha protein (IL1A)

Ask
View Details
Recombinant Human Interleukin-1 alpha protein (IL1A)
MBS9423059-05 1 mg

Recombinant Human Interleukin-1 alpha protein (IL1A)

Ask
View Details
Recombinant Human Interleukin-1 alpha protein (IL1A)
MBS9423059-06 5x 1 mg

Recombinant Human Interleukin-1 alpha protein (IL1A)

Ask
View Details