YebF, E.coli (Myc, His)
YebF protein, existing as a monomer in solution, interacts with OmpF/OmpC at the periplasmic face of the membrane, indicating a role in bacterial membrane-related processes. Its monomeric state emphasizes independent structure, prompting further investigation into the molecular mechanisms and functional impact of its interactions with OmpF/OmpC in the bacterial membrane. YebF Protein, E.coli (Myc, His) is the recombinant E. coli-derived YebF protein, expressed by E. coli , with N-His, C-Myc labeled tag.
Product Specifications
Product Name Alternative
YebF Protein, E.coli (Myc, His), E.coli, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/yebf-protein-e-coli-myc-his.html
Smiles
ANNETSKSVTFPKCEDLDAAGIAASVKRDYQQNRVARWADDQKIVGQADPVAWVSLQDIQGKDDKWSVPLTVRGKSADIHYQVSVDCKAGMAEYQRR
Molecular Formula
946363 (Gene_ID) P33219 (A22-R118) (Accession)
Molecular Weight
Approximately 15.8 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items