Arginase-1/ARG1, Human (HEK293, His)
Arginase-1 Protein, Human (HEK293, His) expresses in HEK293 cells with a His tag at the C-terminus. Arginase-1 Protein inhibits the growth of the arginine-depleting enzyme arginine deiminase (ADI) -resistant Hep3B tumor cells in mice[1].
Product Specifications
Product Name Alternative
Arginase-1/ARG1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/arginase-1-protein-human-hek293-his.html
Purity
98.0
Smiles
SAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Molecular Formula
383 (Gene_ID) P05089 (S2-K322) (Accession)
Molecular Weight
Approximately 38.0 kDa
References & Citations
[1]Sam-Mui Tsui, et al. Pegylated Derivatives of Recombinant Human Arginase (rhArg1) for Sustained in Vivo Activity in Cancer Therapy: Preparation, Characterization and Analysis of Their Pharmacodynamics in Vivo and in Vitro and Action Upon Hepatocellular Carcinoma Cell (HCC) . Cancer Cell Int. 2009 Apr 17;9:9.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10417452 96 Well
Goat Carnitine O palmitoyltransferase 2, mitochondrial (CPT2) ELISA kit
Sign In for Pricing
View Details 
NBP2-89612C 0.1 mL
Rabbit Monoclonal IFN-beta Antibody (040) [DyLight 650]
Sign In for Pricing
View Details orb1660172 96 Tests
Human Serine/threonine-protein kinase TBK1 ELISA Kit
Sign In for Pricing
View Details