Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KGF/FGF-7, Human (CHO)

KGF/FGF-7 Protein, Human (CHO) is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. KGF/FGF-7 Protein and its receptor are important for normal wound healing.

Product Specifications

Product Name Alternative

KGF/FGF-7 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/kgf-fgf-7-protein-human-cho.html

Purity

95.00

Smiles

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Molecular Formula

2252 (Gene_ID) P21781-1 (C32-T194) (Accession)

Molecular Weight

Approximately 16-27, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Trowbridge JM, et al. Dermatan sulfate binds and potentiates activity of keratinocyte growth factor (FGF-7) . J Biol Chem. 2002 Nov 8;277 (45) :42815-20.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC12 Protein Vector (Human) (pPM-C-His)
PV007800 500 ng

CCDC12 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal USP44 Antibody (OTI1D1) [Janelia Fluor 549]
NBP2-74811JF549 0.1 mL

Mouse Monoclonal USP44 Antibody (OTI1D1) [Janelia Fluor 549]

Sign In for Pricing
View Details
Recombinant HPV-19 L2 Protein
VAng-Wyb3076-inquire Inquire

Recombinant HPV-19 L2 Protein

Sign In for Pricing
View Details
ZBTB25 Rabbit pAb
E45R27453N-100 100 µL

ZBTB25 Rabbit pAb

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung: left lower lobe
CS558531 5x 5 µm

Frozen Tissue Sections, Lung: left lower lobe

Sign In for Pricing
View Details
Entris II Advance Preci Bal 320g Cap 1mg Read
BAL4588 1 Each

Entris II Advance Preci Bal 320g Cap 1mg Read

Sign In for Pricing
View Details