Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KGF/FGF-7, Human (CHO)

KGF/FGF-7 Protein, Human (CHO) is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. KGF/FGF-7 Protein and its receptor are important for normal wound healing.

Product Specifications

Product Name Alternative

KGF/FGF-7 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/kgf-fgf-7-protein-human-cho.html

Purity

95.00

Smiles

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Molecular Formula

2252 (Gene_ID) P21781-1 (C32-T194) (Accession)

Molecular Weight

Approximately 16-27, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Trowbridge JM, et al. Dermatan sulfate binds and potentiates activity of keratinocyte growth factor (FGF-7) . J Biol Chem. 2002 Nov 8;277 (45) :42815-20.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNE1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1118307 1.0 µg DNA

KCNE1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ASC2 (PYDC1) Mouse Monoclonal Antibody [Clone ID: OTI5D12]
TA803566S 30 µL

ASC2 (PYDC1) Mouse Monoclonal Antibody [Clone ID: OTI5D12]

Sign In for Pricing
View Details
NTH1 (NTHL1) (NM_002528) Human Tagged ORF Clone
RG214598 10 µg

NTH1 (NTHL1) (NM_002528) Human Tagged ORF Clone

Sign In for Pricing
View Details
RAD17 CytoSection
TS419964P5 25 Slides

RAD17 CytoSection

Sign In for Pricing
View Details
Rabbit Asialo Ganglioside M1 Antibody (Anti-AGM1) ELISA Kit
MBS9380955 Inquire

Rabbit Asialo Ganglioside M1 Antibody (Anti-AGM1) ELISA Kit

Sign In for Pricing
View Details
Cas9 Expressing Monkey Primary Colonic Microvascular Endothelial Cells
NHFF-1123-HX36 Each

Cas9 Expressing Monkey Primary Colonic Microvascular Endothelial Cells

Sign In for Pricing
View Details