Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KGF/FGF-7, Human (CHO)

KGF/FGF-7 Protein, Human (CHO) is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. KGF/FGF-7 Protein and its receptor are important for normal wound healing.

Product Specifications

Product Name Alternative

KGF/FGF-7 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/kgf-fgf-7-protein-human-cho.html

Purity

95.00

Smiles

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Molecular Formula

2252 (Gene_ID) P21781-1 (C32-T194) (Accession)

Molecular Weight

Approximately 16-27, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Trowbridge JM, et al. Dermatan sulfate binds and potentiates activity of keratinocyte growth factor (FGF-7) . J Biol Chem. 2002 Nov 8;277 (45) :42815-20.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm14393 Protein Vector (Mouse) (pPM-C-HA)
PV183204 500 ng

Gm14393 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Genethonin 1 (STBD1) Mouse Monoclonal Antibody [Clone ID: LBI6G5]
AMM20670V 100 µL

Genethonin 1 (STBD1) Mouse Monoclonal Antibody [Clone ID: LBI6G5]

Sign In for Pricing
View Details
NDUFC1 (NM_001184988) Human Tagged Lenti ORF Clone
RC229503L4 10 µg

NDUFC1 (NM_001184988) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ZRSR1 Protein Vector (Rat) (pPM-C-HA)
51956026 500 ng

ZRSR1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral human SPTLC2 sgRNA gene knockout kit - Lentiviral human SPTLC2 sgRNA gene knockout kit (100)
GTR15361960 1 Vial

Lentiviral human SPTLC2 sgRNA gene knockout kit - Lentiviral human SPTLC2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
TNFAIP1 ORF Vector (Human) (pORF)
47189011 1.0 µg DNA

TNFAIP1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details