Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KGF/FGF-7, Human (CHO)

KGF/FGF-7 Protein, Human (CHO) is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. KGF/FGF-7 Protein and its receptor are important for normal wound healing.

Product Specifications

Product Name Alternative

KGF/FGF-7 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/kgf-fgf-7-protein-human-cho.html

Purity

95.00

Smiles

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Molecular Formula

2252 (Gene_ID) P21781-1 (C32-T194) (Accession)

Molecular Weight

Approximately 16-27, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Trowbridge JM, et al. Dermatan sulfate binds and potentiates activity of keratinocyte growth factor (FGF-7) . J Biol Chem. 2002 Nov 8;277 (45) :42815-20.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apoptosis repressor with CARD (NOL3) (NM_001185057) Human Recombinant Protein
TP720132M 50 µg

Apoptosis repressor with CARD (NOL3) (NM_001185057) Human Recombinant Protein

Sign In for Pricing
View Details
ERCC8 Human Gene Knockout Kit (CRISPR)
KN203124RB 1 Kit

ERCC8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Prl7b1 Rat shRNA Plasmid (Locus ID 266804)
TR713244 1 Kit

Prl7b1 Rat shRNA Plasmid (Locus ID 266804)

Sign In for Pricing
View Details
SCEL Protein Vector (Human) (pPM-C-HA)
43141021 500 ng

SCEL Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
N- (2-Fluorophenyl) -2-[7- (3-methylbenzyl) -3,8-dioxo-5,6,7,8-tetrahydro[1,2,4]triazolo[4,3-a]pyrazin-2 (3H) -yl]acetamide
sc-494647 5 mg

N- (2-Fluorophenyl) -2-[7- (3-methylbenzyl) -3,8-dioxo-5,6,7,8-tetrahydro[1,2,4]triazolo[4,3-a]pyrazin-2 (3H) -yl]acetamide

Sign In for Pricing
View Details
LAMP2a Recombinant Rabbit monoclonal Antibody
HA750016 100 µL

LAMP2a Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details