Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KGF/FGF-7, Human (CHO)

KGF/FGF-7 Protein, Human (CHO) is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. KGF/FGF-7 Protein and its receptor are important for normal wound healing.

Product Specifications

Product Name Alternative

KGF/FGF-7 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/kgf-fgf-7-protein-human-cho.html

Purity

95.00

Smiles

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Molecular Formula

2252 (Gene_ID) P21781-1 (C32-T194) (Accession)

Molecular Weight

Approximately 16-27, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Trowbridge JM, et al. Dermatan sulfate binds and potentiates activity of keratinocyte growth factor (FGF-7) . J Biol Chem. 2002 Nov 8;277 (45) :42815-20.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMELX (NM_182681) Human Tagged ORF Clone
RG215005 10 µg

AMELX (NM_182681) Human Tagged ORF Clone

Sign In for Pricing
View Details
MORC2 Antibody
MBS1497857-01 0.05 mg

MORC2 Antibody

Sign In for Pricing
View Details
MORC2 Antibody
MBS1497857-02 0.1 mg

MORC2 Antibody

Sign In for Pricing
View Details
MORC2 Antibody
MBS1497857-03 5x 0.1 mg

MORC2 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal TAO Kinase 1 Antibody (TAO1 1.2) [Alexa Fluor 594]
NBP2-50324AF594 0.1 mL

Mouse Monoclonal TAO Kinase 1 Antibody (TAO1 1.2) [Alexa Fluor 594]

Sign In for Pricing
View Details
MNDA
568870-01 50 µg

MNDA

Sign In for Pricing
View Details