Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KGF/FGF-7, Human (CHO)

KGF/FGF-7 Protein, Human (CHO) is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. KGF/FGF-7 Protein and its receptor are important for normal wound healing.

Product Specifications

Product Name Alternative

KGF/FGF-7 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/kgf-fgf-7-protein-human-cho.html

Purity

95.00

Smiles

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Molecular Formula

2252 (Gene_ID) P21781-1 (C32-T194) (Accession)

Molecular Weight

Approximately 16-27, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Trowbridge JM, et al. Dermatan sulfate binds and potentiates activity of keratinocyte growth factor (FGF-7) . J Biol Chem. 2002 Nov 8;277 (45) :42815-20.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ctdp1 Mouse shRNA Plasmid (Locus ID 67655)
TL514886 1 Kit

Ctdp1 Mouse shRNA Plasmid (Locus ID 67655)

Sign In for Pricing
View Details
Influenza A virus/Flu-A Monoclonal Antibody
E55A11360 100 µL

Influenza A virus/Flu-A Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Stx5a activation kit by CRISPRa
GA205941 1 Kit

Mouse Stx5a activation kit by CRISPRa

Sign In for Pricing
View Details
UCN2 Human qPCR Primer Pair (NM_033199)
HP216357 200 Reactions

UCN2 Human qPCR Primer Pair (NM_033199)

Sign In for Pricing
View Details
Precision Balance BBAL-218
BBAL-218 1 Unit

Precision Balance BBAL-218

Sign In for Pricing
View Details
LIPT2 Knockout Hela Polyclonal Cells
ARG7804 1 Million

LIPT2 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details