Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus NL63 Envelope small membrane protein (E)

Product Specifications

Product Name Alternative

Short name: E protein Short name: sM protein

Abbreviation

Recombinant Human coronavirus NL63 Envelope small membrane protein

Gene Name

E

UniProt

Q6Q1S0

Expression Region

1-77aa

Organism

Human coronavirus NL63 (HCoV-NL63)

Target Sequence

MFLRLIDDNGIVLNSILWLLVMIFFFVLAMTFIKLIQLCFTCHYFFSRTLYQPVYKIFLAYQDYMQIAPVPAEVLNV

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & Developed Protein & Coronavirus Protein

Source

In vitro E.coli expression system

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

12.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (K8/383), CF568 conjugate, 0.1mg/mL
BNC680383-100 1x 100 µL

Cytokeratin 8 (K8/383), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG F(c) Antibody
TA397728 5 mg

Human IgG F(c) Antibody

Sign In for Pricing
View Details
Mouse GAL3 Antibody Pair Set
E-KAB-0690 50 µL & 100 µg

Mouse GAL3 Antibody Pair Set

Sign In for Pricing
View Details
Banf1 (NM_011793) Mouse Tagged ORF Clone
MG200222 10 µg

Banf1 (NM_011793) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SDF1 (CXCL12) (NM_000609) Human Over-expression Lysate
LC424610 20 µg

SDF1 (CXCL12) (NM_000609) Human Over-expression Lysate

Sign In for Pricing
View Details
GRIN3B Polyclonal Antibody
E-AB-90066-01 60 µL

GRIN3B Polyclonal Antibody

Sign In for Pricing
View Details