Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prostasin/PRSS8, Human (HEK293, His)

Prostasin/PRSS8, with trypsin-like cleavage specificity, crucially activates the epithelial sodium channel (ENaC) by cleaving its gamma subunits (SCNN1G) . This protein forms a heterodimeric complex, consisting of light and heavy chains connected by a disulfide bond. Prostasin/PRSS8 Protein, Human (HEK293, His) is the recombinant human-derived Prostasin/PRSS8 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Prostasin/PRSS8 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prostasin-prss8-protein-human-hek293-his.html

Purity

98.00

Smiles

AEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLR

Molecular Formula

5652 (Gene_ID) Q16651 (A30-R322) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Phospholipase D (PLD) ELISA Kit
DL-PLD-Hu-01 48 Tests

Human Phospholipase D (PLD) ELISA Kit

Sign In for Pricing
View Details
Human Phospholipase D (PLD) ELISA Kit
DL-PLD-Hu-02 96 Tests

Human Phospholipase D (PLD) ELISA Kit

Sign In for Pricing
View Details
7-Chloro-1-(4-fluorophenyl)-1-heptanone
TRC-C171020-250MG 250 mg

7-Chloro-1-(4-fluorophenyl)-1-heptanone

Sign In for Pricing
View Details
Human MRPL21 qPCR Primer Pair
QH68609S 200 Tests

Human MRPL21 qPCR Primer Pair

Sign In for Pricing
View Details
LNG1 Antibody
orb791908 2 mg

LNG1 Antibody

Sign In for Pricing
View Details
West Nile Virus Envelope Protein ELISA Kit
VPK-5154 96 Assays

West Nile Virus Envelope Protein ELISA Kit

Sign In for Pricing
View Details