Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free G-CSF, Human (His)

G-CSF, a pivotal cytokine, regulates hematopoiesis by controlling the production, differentiation, and function of granulocytes and monocytes-macrophages. This monomeric protein specifically promotes granulocyte development, playing a crucial role in immune system regulation and blood cell formation. Animal-Free G-CSF Protein, Human (His) is the recombinant human-derived animal-FreeG-CSF protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free G-CSF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-g-csf-protein-human-his.html

Purity

95.0

Smiles

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Molecular Formula

1440 (Gene_ID) P09919-2 (T31-P204) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
BNC471820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-500 1x 500 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL
BNC400029-500 1x 500 µL

Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T-Cell Leukemia Marker) (CD7/3737), CF405S conjugate, 0.1mg/mL
BNC042056-100 1x 100 µL

CD7 (T-Cell Leukemia Marker) (CD7/3737), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (158-4D3), CF594 conjugate, 0.1mg/mL
BNC940028-500 1x 500 µL

CD45RA (158-4D3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311 + OCA1/812), CF568 conjugate, 0.1mg/mL
BNC680908-500 1x 500 µL

Tyrosinase (T311 + OCA1/812), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details