Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free G-CSF, Human (His)

G-CSF, a pivotal cytokine, regulates hematopoiesis by controlling the production, differentiation, and function of granulocytes and monocytes-macrophages. This monomeric protein specifically promotes granulocyte development, playing a crucial role in immune system regulation and blood cell formation. Animal-Free G-CSF Protein, Human (His) is the recombinant human-derived animal-FreeG-CSF protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free G-CSF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-g-csf-protein-human-his.html

Purity

95.0

Smiles

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Molecular Formula

1440 (Gene_ID) P09919-2 (T31-P204) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 (At1g67520), partial
MBS1060939-01 0.5 mg (E-Coli)

Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 (At1g67520), partial

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 (At1g67520), partial
MBS1060939-02 0.05 mg (Baculovirus)

Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 (At1g67520), partial

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 (At1g67520), partial
MBS1060939-03 0.5 mg (Yeast)

Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 (At1g67520), partial

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 (At1g67520), partial
MBS1060939-04 0.05 mg (Mammalian-Cell)

Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 (At1g67520), partial

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 (At1g67520), partial
MBS1060939-05 1 mg (E-Coli)

Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 (At1g67520), partial

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 (At1g67520), partial
MBS1060939-06 0.1 mg (Baculovirus)

Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 (At1g67520), partial

Sign In for Pricing
View Details