Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Desmin (DES)

Product Specifications

CAS Number

9000-83-3

Gene Name

DES

UniProt

P17661

Expression Region

2-470aa

Organism

Homo sapiens

Target Sequence

SQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Tag

C-terminal EGFP-tagged

Source

E.coli

Field of Research

Cancer

Assay Type

In Stock Protein

Relevance

Muscle-specific type III intermediate filament essential for proper muscular structure and function. Plays a crucial role in maintaining the structure of sarcomeres, inter-connecting the Z-disks and forming the myofibrils, linking them not only to the sarcolemmal cytoskeleton, but also to the nucleus and mitochondria, thus providing strength for the muscle fiber during activity. In adult striated muscle they form a fibrous network connecting myofibrils to each other and to the plasma membrane from the periphery of the Z-line structures. May act as a sarcomeric microtubule-anchoring protein: specifically associates with detyrosinated tubulin-alpha chains, leading to buckled microtubules and mechanical resistance to contraction. Contributes to the transcriptional regulation of the NKX2-5 gene in cardiac progenitor cells during a short period of cardiomyogenesis and in cardiac side population stem cells in the adult. Plays a role in maintaining an optimal conformation of nebulette (NEB) on heart muscle sarcomeres to bind and recruit cardiac alpha-actin.

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length of Mature Protein

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

80.5 kDa

References & Citations

"Desmin mutation responsible for idiopathic dilated cardiomyopathy." Li D., Tapscoft T., Gonzalez O., Burch P.E., Quinones M.A., Zoghbi W.A., Hill R., Bachinski L.L., Mann D.L., Roberts R. Circulation 100:461-464 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Coagulation Factor VII (F7) Antibody Pair Kit (with Standard)
MBS2100994-01 5x 96 Tests

Bovine Coagulation Factor VII (F7) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Bovine Coagulation Factor VII (F7) Antibody Pair Kit (with Standard)
MBS2100994-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Bovine Coagulation Factor VII (F7) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Bovine Coagulation Factor VII (F7) Antibody Pair Kit (with Standard)
MBS2100994-03 10x 96 Tests

Bovine Coagulation Factor VII (F7) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Bovine Coagulation Factor VII (F7) Antibody Pair Kit (with Standard)
MBS2100994-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Bovine Coagulation Factor VII (F7) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
PIP5KI gamma (PIP5K1C) Rabbit Polyclonal Antibody
TA366934 100 µL

PIP5KI gamma (PIP5K1C) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(R) -3-Fluoropyrrolidine-1-sulfonyl chloride
PC540072-01 100 mg

(R) -3-Fluoropyrrolidine-1-sulfonyl chloride

Sign In for Pricing
View Details