Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIF, Mouse (HEK293)

LIF (Leukemia Inhibitory Factor) prompts terminal differentiation in leukemic cells, inducing hematopoietic and neuronal cell differentiation. It also stimulates acute-phase protein synthesis in hepatocytes. LIF's multifaceted role underscores its significance in regulating hematopoiesis, neurogenesis, and hepatic responses. LIF Protein, Mouse (HEK293) is the recombinant mouse-derived LIF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

LIF Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lif-protein-mouse-hek293.html

Purity

96.20

Smiles

SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

Molecular Formula

16878 (Gene_ID) P09056/NP_032527.1 (S24-F203) (Accession)

Molecular Weight

Approximately 35.6 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1560146 Rat shRNA Plasmid (Locus ID 500505)
TR708764 1 Kit

RGD1560146 Rat shRNA Plasmid (Locus ID 500505)

Sign In for Pricing
View Details
FURIN (NM_002569) Human Tagged ORF Clone Lentiviral Particle
RC204279L1V 200 µL

FURIN (NM_002569) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Alprenolol hydrochloride
orb1220036-01 1 g

Alprenolol hydrochloride

Sign In for Pricing
View Details
Alprenolol hydrochloride
orb1220036-02 50 mg

Alprenolol hydrochloride

Sign In for Pricing
View Details
Alprenolol hydrochloride
orb1220036-03 100 mg

Alprenolol hydrochloride

Sign In for Pricing
View Details
Alprenolol hydrochloride
orb1220036-04 200 mg

Alprenolol hydrochloride

Sign In for Pricing
View Details