Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Complement C3a, Mouse

Complement C3/C3a protein activates the complement system, playing a central role in both classical and alternative pathways. C3b binds covalently to cell surface carbohydrates or immune aggregates, while C3a acts as an inflammatory mediator, inducing neutrophil chemoattraction and promoting smooth muscle contraction, increased vascular permeability, and histamine release. The shorter isoform of C3a stimulates B-cells. Complement C3a Protein, Mouse is the recombinant mouse-derived Complement C3/C3a protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Complement C3a Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/complement-c3-c3a-protein-mouse.html

Purity

96.00

Smiles

SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR

Molecular Formula

12266 (Gene_ID) P01027-1 (S671-R748) (Accession)

Molecular Weight

Approximately 10 kDa

References & Citations

[1]Shi S, et al., The complement C3a/C3aR pathway is associated with treatment resistance to gemcitabine-based neoadjuvant therapy in pancreatic cancer. Comput Struct Biotechnol J. 2024 Oct 5;23:3634-3650.|[2]Li S, et al., Microglia mediate memory dysfunction via excitatory synaptic elimination in a fracture surgery mouse model. J Neuroinflammation. 2024 Sep 16;21 (1) :227.|[3]Zhang L, et al., C-reactive protein inhibits C3a/C3aR-dependent podocyte autophagy in favor of diabetic kidney disease. FASEB J. 2022 Jun;36 (6) :e22332.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED27 Antibody (FITC)
abx308119-01 20 µg

MED27 Antibody (FITC)

Sign In for Pricing
View Details
MED27 Antibody (FITC)
abx308119-02 50 µg

MED27 Antibody (FITC)

Sign In for Pricing
View Details
MED27 Antibody (FITC)
abx308119-03 100 µg

MED27 Antibody (FITC)

Sign In for Pricing
View Details
MED27 Antibody (FITC)
abx308119-04 200 µg

MED27 Antibody (FITC)

Sign In for Pricing
View Details
MED27 Antibody (FITC)
abx308119-05 1 mg

MED27 Antibody (FITC)

Sign In for Pricing
View Details
LOC688298 Protein Vector (Rat) (pPM-C-HA)
PV279364 500 ng

LOC688298 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details