Amphiregulin, Mouse (HEK293, Fc)
Amphiregulin Protein, an EGFR ligand, acts as an autocrine growth factor and mitogen for diverse cells, including astrocytes, Schwann cells, and fibroblasts. Engaging with CNIH in its immature stage, Amphiregulin's EGFR activation emphasizes its vital role in regulating cell growth and orchestrating various cellular functions across different cell types. Amphiregulin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Amphiregulin protein, expressed by HEK293 , with N-hFc labeled tag.
Product Specifications
Product Name Alternative
Amphiregulin Protein, Mouse (HEK293, Fc), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/amphiregulin-protein-mouse-hek293-fc.html
Purity
95.00
Smiles
VIKPKKNKTEGEKSTEKPKRKKKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLEVVTCNCHQDYFGERCGEKSMKTHSEDDKDLSKIAVVAVTIFVSAIILAAIGIGIVITVHLWKRYFREYEGETEERRRLRQENGTVHAIA
Molecular Formula
11839 (Gene_ID) P31955 (V100-A248) (Accession)
Molecular Weight
45-50 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2759), CF647 conjugate, 0.1mg/mL
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
Thyroglobulin (Thyroidal Cell Marker) (r6E1), CF488A conjugate, 0.1mg/mL
