Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Macrophage colony-stimulating factor 1 (CSF1), partial (Active)

Product Specifications

Product Name Alternative

Macrophage colony-stimulating factor 1; CSF-1; M-CSF; MCSF; Lanimostim; Proteoglycan macrophage colony-stimulating factor; Processed macrophage colony-stimulating factor 1; Macrophage colony-stimulating factor 1 43 kDa subunit; CSF1

Abbreviation

Recombinant Human CSF1 protein, partial (Active)

Gene Name

CSF1

UniProt

P09603

Expression Region

33-190aa

Organism

Homo sapiens (Human)

Target Sequence

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN

Tag

C-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein

Source

Yeast

Field of Research

Cardiovascular

Relevance

Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of pro-inflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of THP-1 cells is 0.5913-1.205 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.9 kDa

References & Citations

Functional overlap but differential expression of CSF-1 and IL-34 in their CSF-1 receptor-mediated regulation of myeloid cells. Wei S., Nandi S., Chitu V., Yeung Y.G., Yu W., Huang M., Williams L.T., Lin H., Stanley E.R. J. Leukoc. Biol. 88:495-505 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5’-Iodo-5’-deoxy Adenosine
TRC-I705000-250MG 250 mg

5’-Iodo-5’-deoxy Adenosine

Sign In for Pricing
View Details
2,2'-(2-Hydroxypropane-1,3-diyl)bis(1H-isoindole-1,3(2H)-dione)
TRC-H950710-10G 10 g

2,2'-(2-Hydroxypropane-1,3-diyl)bis(1H-isoindole-1,3(2H)-dione)

Sign In for Pricing
View Details
CAPSL (NM_001042625) Human Recombinant Protein
TP305410 20 µg

CAPSL (NM_001042625) Human Recombinant Protein

Sign In for Pricing
View Details
JNK1 (MAPK8) (pT-G/P-pY Motif) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 9H8]
AM00082PU-N 100 µg

JNK1 (MAPK8) (pT-G/P-pY Motif) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 9H8]

Sign In for Pricing
View Details
Nxt1 (NM_019761) Mouse Tagged ORF Clone
MG200891 10 µg

Nxt1 (NM_019761) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
BTC Antibody
KC-7558-01 50 μL

BTC Antibody

Sign In for Pricing
View Details