Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Horse Growth/differentiation factor 8 (MSTN)

Product Specifications

Product Name Alternative

(GDF-8) (Myostatin)

Abbreviation

Recombinant Horse MSTN protein

Gene Name

MSTN

UniProt

Q9GM97

Expression Region

267-375aa

Organism

Equus caballus (Horse)

Target Sequence

DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Acts specifically as a negative regulator of skeletal muscle growth.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.4 kDa

References & Citations

"Molecular cloning of equine myostatin cDNA and serum level of myostatin in horse." Hosoyama T., Yamanouchi K., Tojo H., Tachi C.

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cyclin H (CCNH) activation kit by CRISPRa
GA100633 1 Kit

Human Cyclin H (CCNH) activation kit by CRISPRa

Sign In for Pricing
View Details
Aspartate Aminotransferase (GOT1) Rabbit Polyclonal Antibody
TA384312 100 µL

Aspartate Aminotransferase (GOT1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Soft tissue
CR559671 5 µg

Tissue Total RNA, Soft tissue

Sign In for Pricing
View Details
NAA60 (NM_024845) Human Recombinant Protein
TP317832 20 µg

NAA60 (NM_024845) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS514343 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
BANF2 (NM_001014977) Human Over-expression Lysate
LY423098 100 µg

BANF2 (NM_001014977) Human Over-expression Lysate

Sign In for Pricing
View Details