Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kallikrein-12 (KLK12)

Product Specifications

Product Name Alternative

(Kallikrein-like protein 5) (KLK-L5)

Abbreviation

Recombinant Human KLK12 protein

Gene Name

KLK12

UniProt

Q9UKR0

Expression Region

18-248aa

Organism

Homo sapiens (Human)

Target Sequence

ATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSRYWVRLGEHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATCHGVYPGRITSNMVCAGGVPGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQDGIPGVYTYICKYVDWIRMIMRNN

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.4 kDa

References & Citations

"Enzymatic properties of human kallikrein-related peptidase 12 (KLK12) ." Memari N., Jiang W., Diamandis E.P., Luo L.Y. Biol Chem 388:427-435 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey WNT Inhibitory Factor 1 ELISA Kit
MBS079632-01 48 Well

Monkey WNT Inhibitory Factor 1 ELISA Kit

Sign In for Pricing
View Details
Monkey WNT Inhibitory Factor 1 ELISA Kit
MBS079632-02 96 Well

Monkey WNT Inhibitory Factor 1 ELISA Kit

Sign In for Pricing
View Details
Monkey WNT Inhibitory Factor 1 ELISA Kit
MBS079632-03 5x 96 Well

Monkey WNT Inhibitory Factor 1 ELISA Kit

Sign In for Pricing
View Details
Monkey WNT Inhibitory Factor 1 ELISA Kit
MBS079632-04 10x 96 Well

Monkey WNT Inhibitory Factor 1 ELISA Kit

Sign In for Pricing
View Details
Rabbit 1,25 (OH) 2D3 ELISA Kit
MBS2600413-01 48 Well

Rabbit 1,25 (OH) 2D3 ELISA Kit

Sign In for Pricing
View Details
Rabbit 1,25 (OH) 2D3 ELISA Kit
MBS2600413-02 96 Well

Rabbit 1,25 (OH) 2D3 ELISA Kit

Sign In for Pricing
View Details