Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M-CSF, Human (CHO)

M-CSF (CSF-1) protein is a homodimeric hematopoietic growth factor and proinflammatory cytokine, belonging to the colony stimulating factor. M-CSF can act specifically on the monocyte-macrophage lineage, drive monocyte proliferation and differentiation into macrophages/osteoclasts, and induce M1 macrophages to enhance ADCC anti-tumor activity and M2 macrophages to promote VEGF angiogenesis[1][2][3][4]. M-CSF Protein, Human (CHO) is a recombinant human M-CSF protein expressed in CHO cells with tag-free.

Product Specifications

Product Name Alternative

M-CSF Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/m-csf-protein-human-cho.html

Purity

95.00

Smiles

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

Molecular Formula

1435 (Gene_ID) P09603-3 (E33-S190) (Accession)

Molecular Weight

Approximately 18-22 kDa under reduced (R) conditions, 32-40 kDa under non reducing (N) conditions, based on SDS-PAGE due to the glycosylation.

References & Citations

[1]Garnick MB, et al. Preclinical and clinical evaluation of recombinant human macrophage colony-stimulating factor (rhM-CSF) . Int J Cell Cloning. 1990 Jan;8 Suppl 1:356-71.|[2]Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8 (7) :533-44.|[3]Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58 (8) :2257-67.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pycr1 3'UTR Luciferase Stable Cell Line
TU217136 1.0 mL

Pycr1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Complement C8A (C8A) Human qPCR Primer Pair (NM_000562)
HP200533 200 Reactions

Complement C8A (C8A) Human qPCR Primer Pair (NM_000562)

Sign In for Pricing
View Details
Mouse Monoclonal IL-2 Antibody (B-G5) [Alexa Fluor 750]
NBP3-14593AF750 0.1 mL

Mouse Monoclonal IL-2 Antibody (B-G5) [Alexa Fluor 750]

Sign In for Pricing
View Details
MFF Antibody
CSB-PA834434-01 50 μL

MFF Antibody

Sign In for Pricing
View Details
MFF Antibody
CSB-PA834434-02 100 µL

MFF Antibody

Sign In for Pricing
View Details
Phospho-PLCG1 (Tyr783) Colorimetric Cell-Based ELISA Kit (OKAG01519)
OKAG01519 2x 96 Well

Phospho-PLCG1 (Tyr783) Colorimetric Cell-Based ELISA Kit (OKAG01519)

Sign In for Pricing
View Details