Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M-CSF, Human (CHO)

M-CSF (CSF-1) protein is a homodimeric hematopoietic growth factor and proinflammatory cytokine, belonging to the colony stimulating factor. M-CSF can act specifically on the monocyte-macrophage lineage, drive monocyte proliferation and differentiation into macrophages/osteoclasts, and induce M1 macrophages to enhance ADCC anti-tumor activity and M2 macrophages to promote VEGF angiogenesis[1][2][3][4]. M-CSF Protein, Human (CHO) is a recombinant human M-CSF protein expressed in CHO cells with tag-free.

Product Specifications

Product Name Alternative

M-CSF Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/m-csf-protein-human-cho.html

Purity

95.00

Smiles

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

Molecular Formula

1435 (Gene_ID) P09603-3 (E33-S190) (Accession)

Molecular Weight

Approximately 18-22 kDa under reduced (R) conditions, 32-40 kDa under non reducing (N) conditions, based on SDS-PAGE due to the glycosylation.

References & Citations

[1]Garnick MB, et al. Preclinical and clinical evaluation of recombinant human macrophage colony-stimulating factor (rhM-CSF) . Int J Cell Cloning. 1990 Jan;8 Suppl 1:356-71.|[2]Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8 (7) :533-44.|[3]Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58 (8) :2257-67.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurotrophin 4 (NTF4) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E8]
TA500034AM 100 µL

Neurotrophin 4 (NTF4) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E8]

Sign In for Pricing
View Details
Sputum DNA Isolation Kit
46200 25 Preparations

Sputum DNA Isolation Kit

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2990R), 1mg/mL
BNUM2990-50 1x 50 µL

CD63 (Late Endosomes Marker) (LAMP3/2990R), 1mg/mL

Sign In for Pricing
View Details
Protein Z (PROZ) Mouse Monoclonal Antibody [Clone ID: OTI4A9]
CF806742 100 µg

Protein Z (PROZ) Mouse Monoclonal Antibody [Clone ID: OTI4A9]

Sign In for Pricing
View Details
Tissue FFPE Sections, Rectum
CS809125 5x 5 µm

Tissue FFPE Sections, Rectum

Sign In for Pricing
View Details
Thebaine
TRC-T342450-5MG 5 mg

Thebaine

Sign In for Pricing
View Details