M-CSF, Human (CHO)

M-CSF (CSF-1) protein is a homodimeric hematopoietic growth factor and proinflammatory cytokine, belonging to the colony stimulating factor. M-CSF can act specifically on the monocyte-macrophage lineage, drive monocyte proliferation and differentiation into macrophages/osteoclasts, and induce M1 macrophages to enhance ADCC anti-tumor activity and M2 macrophages to promote VEGF angiogenesis[1][2][3][4]. M-CSF Protein, Human (CHO) is a recombinant human M-CSF protein expressed in CHO cells with tag-free.

Product Specifications

Product Name Alternative

M-CSF Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/m-csf-protein-human-cho.html

Purity

95.00

Smiles

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

Molecular Formula

1435 (Gene_ID) P09603-3 (E33-S190) (Accession)

Molecular Weight

Approximately 18-22 kDa under reduced (R) conditions, 32-40 kDa under non reducing (N) conditions, based on SDS-PAGE due to the glycosylation.

References & Citations

[1]Garnick MB, et al. Preclinical and clinical evaluation of recombinant human macrophage colony-stimulating factor (rhM-CSF) . Int J Cell Cloning. 1990 Jan;8 Suppl 1:356-71.|[2]Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8 (7) :533-44.|[3]Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58 (8) :2257-67.