Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M-CSF, Human (CHO)

M-CSF (CSF-1) protein is a homodimeric hematopoietic growth factor and proinflammatory cytokine, belonging to the colony stimulating factor. M-CSF can act specifically on the monocyte-macrophage lineage, drive monocyte proliferation and differentiation into macrophages/osteoclasts, and induce M1 macrophages to enhance ADCC anti-tumor activity and M2 macrophages to promote VEGF angiogenesis[1][2][3][4]. M-CSF Protein, Human (CHO) is a recombinant human M-CSF protein expressed in CHO cells with tag-free.

Product Specifications

Product Name Alternative

M-CSF Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/m-csf-protein-human-cho.html

Purity

95.00

Smiles

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

Molecular Formula

1435 (Gene_ID) P09603-3 (E33-S190) (Accession)

Molecular Weight

Approximately 18-22 kDa under reduced (R) conditions, 32-40 kDa under non reducing (N) conditions, based on SDS-PAGE due to the glycosylation.

References & Citations

[1]Garnick MB, et al. Preclinical and clinical evaluation of recombinant human macrophage colony-stimulating factor (rhM-CSF) . Int J Cell Cloning. 1990 Jan;8 Suppl 1:356-71.|[2]Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8 (7) :533-44.|[3]Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58 (8) :2257-67.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Acetyl CoA acetyltransferase, mitochondrial (ACAT1) ELISA kit
GTR10377407 96 Well

Bovine Acetyl CoA acetyltransferase, mitochondrial (ACAT1) ELISA kit

Sign In for Pricing
View Details
GDI2P siRNA Oligos set (Human)
57970171 3x 5 nmol

GDI2P siRNA Oligos set (Human)

Sign In for Pricing
View Details
PTP4A3 Antibody
GWB-MS159F 50 µg

PTP4A3 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Slc39a12 shRNA (UAS) - Lentiviral mouse Slc39a12 shRNA (UAS, RFP) (25)
GTR15181763 1 Vial

Lentiviral mouse Slc39a12 shRNA (UAS) - Lentiviral mouse Slc39a12 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
IL-20R alpha Rabbit Polyclonal Antibody (AP)
orb1602465 100 µL

IL-20R alpha Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Mouse Monoclonal ICT Antibody (OTI2F9) - Azide and BSA Free
NBP2-70976 100 µg

Mouse Monoclonal ICT Antibody (OTI2F9) - Azide and BSA Free

Sign In for Pricing
View Details