Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM156, Human (HEK293, His)

TMEM156 Protein is a member of transmembrane proteins (TMEM) family. The expression levels of TMEM156 correlates with patient survival. TMEM156 is upregulated in tumor tissue. Many genes positively correlated with TMEM156 are involved in multiple immunological processes. Furthermore, genes negatively correlated with TMEM156 are linked with RHO GTPase effectors, which results in a poorer response to receptor activation, thus reducing cancer cell proliferation, survival, and migration. TMEM156 Protein, Human (HEK293, His) is the recombinant human-derived TMEM156 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMEM156 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmem156-protein-human-hek293-his.html

Purity

95.30

Smiles

KTPKERTLELSCLEVCLQSNFTYSLSSLNFSFVTFLQPVRETQIIMRIFLNPSNFRNFTRTCQDITGEFKMCSSCLVCEPKGNMDFISQEQTSKVLIRRGSMEVKANDFHSPCQHFNFSVAPLVDHLEEYNTTCHLKNHTGRSTIMEDEPSKEKSINYTCRIMEYPNDCIHISLHLEMDIKNITCS

Molecular Formula

80008 (Gene_ID) AAH30803.1 (K26-S211) (Accession)

Molecular Weight

Approximately 35-55 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CEACAM-18 Alexa Fluor 350 Antibody (1057633)
FAB9869U-100UG 100 µg

Human CEACAM-18 Alexa Fluor 350 Antibody (1057633)

Sign In for Pricing
View Details
BST-1 discontinued
347076-01 100 µL

BST-1 discontinued

Sign In for Pricing
View Details
BST-1 discontinued
347076-02 200 µL

BST-1 discontinued

Sign In for Pricing
View Details
Khdc4 Mouse shRNA Lentiviral Particle (Locus ID 74200)
TL504946V 500 µL Each

Khdc4 Mouse shRNA Lentiviral Particle (Locus ID 74200)

Sign In for Pricing
View Details
ACY2, NT (Aminoacylase-2, ACY-2, Aspartoacylase, ASP, ASPA) (MaxLight 490) discontinued
A1374-08-ML490 100 µL

ACY2, NT (Aminoacylase-2, ACY-2, Aspartoacylase, ASP, ASPA) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal Arginase 1/ARG1/liver Arginase Antibody (OTI4E6) [DyLight 680]
NBP2-70204FR 0.1 mL

Mouse Monoclonal Arginase 1/ARG1/liver Arginase Antibody (OTI4E6) [DyLight 680]

Sign In for Pricing
View Details