Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM156, Human (HEK293, His)

TMEM156 Protein is a member of transmembrane proteins (TMEM) family. The expression levels of TMEM156 correlates with patient survival. TMEM156 is upregulated in tumor tissue. Many genes positively correlated with TMEM156 are involved in multiple immunological processes. Furthermore, genes negatively correlated with TMEM156 are linked with RHO GTPase effectors, which results in a poorer response to receptor activation, thus reducing cancer cell proliferation, survival, and migration. TMEM156 Protein, Human (HEK293, His) is the recombinant human-derived TMEM156 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMEM156 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmem156-protein-human-hek293-his.html

Purity

95.30

Smiles

KTPKERTLELSCLEVCLQSNFTYSLSSLNFSFVTFLQPVRETQIIMRIFLNPSNFRNFTRTCQDITGEFKMCSSCLVCEPKGNMDFISQEQTSKVLIRRGSMEVKANDFHSPCQHFNFSVAPLVDHLEEYNTTCHLKNHTGRSTIMEDEPSKEKSINYTCRIMEYPNDCIHISLHLEMDIKNITCS

Molecular Formula

80008 (Gene_ID) AAH30803.1 (K26-S211) (Accession)

Molecular Weight

Approximately 35-55 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polybead® Carboxylate Yellow Dyed Microspheres 3.00µm
19124-5 5 mL

Polybead® Carboxylate Yellow Dyed Microspheres 3.00µm

Sign In for Pricing
View Details
EWSR1 Mouse Monoclonal Antibody [Clone ID: OTI2B3]
TA813053 100 µL

EWSR1 Mouse Monoclonal Antibody [Clone ID: OTI2B3]

Sign In for Pricing
View Details
F-box only protein 32 (FBXO32) Human ELISA Kit
D3156 96 Tests

F-box only protein 32 (FBXO32) Human ELISA Kit

Sign In for Pricing
View Details
Polyclonal Goat Anti-TRAF2 Antibody
APG00345G 0.1mg

Polyclonal Goat Anti-TRAF2 Antibody

Sign In for Pricing
View Details
UBE2A (Ubiquitin-conjugating Enzyme E2 A, RAD6 Homolog A, RAD6A, HR6A, hHR6A, Ubiquitin Carrier Protein A, Ubiquitin-protein Ligase A) (AP)
MBS6134409-01 0.1 mL

UBE2A (Ubiquitin-conjugating Enzyme E2 A, RAD6 Homolog A, RAD6A, HR6A, hHR6A, Ubiquitin Carrier Protein A, Ubiquitin-protein Ligase A) (AP)

Sign In for Pricing
View Details
UBE2A (Ubiquitin-conjugating Enzyme E2 A, RAD6 Homolog A, RAD6A, HR6A, hHR6A, Ubiquitin Carrier Protein A, Ubiquitin-protein Ligase A) (AP)
MBS6134409-02 5x 0.1 mL

UBE2A (Ubiquitin-conjugating Enzyme E2 A, RAD6 Homolog A, RAD6A, HR6A, hHR6A, Ubiquitin Carrier Protein A, Ubiquitin-protein Ligase A) (AP)

Sign In for Pricing
View Details