Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM156, Human (HEK293, His)

TMEM156 Protein is a member of transmembrane proteins (TMEM) family. The expression levels of TMEM156 correlates with patient survival. TMEM156 is upregulated in tumor tissue. Many genes positively correlated with TMEM156 are involved in multiple immunological processes. Furthermore, genes negatively correlated with TMEM156 are linked with RHO GTPase effectors, which results in a poorer response to receptor activation, thus reducing cancer cell proliferation, survival, and migration. TMEM156 Protein, Human (HEK293, His) is the recombinant human-derived TMEM156 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMEM156 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmem156-protein-human-hek293-his.html

Purity

95.30

Smiles

KTPKERTLELSCLEVCLQSNFTYSLSSLNFSFVTFLQPVRETQIIMRIFLNPSNFRNFTRTCQDITGEFKMCSSCLVCEPKGNMDFISQEQTSKVLIRRGSMEVKANDFHSPCQHFNFSVAPLVDHLEEYNTTCHLKNHTGRSTIMEDEPSKEKSINYTCRIMEYPNDCIHISLHLEMDIKNITCS

Molecular Formula

80008 (Gene_ID) AAH30803.1 (K26-S211) (Accession)

Molecular Weight

Approximately 35-55 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbmy1a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3242908 1.0 µg DNA

Rbmy1a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal TTMP Antibody [Janelia Fluor 646]
NBP2-97345JF646 0.1 mL

Rabbit Polyclonal TTMP Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
ZFP64 CRISPRa sgRNA lentivector (set of three targets)(Rat)
51063126 3x 1.0µg DNA

ZFP64 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Goat Anti-Human IgG, Bovine/Horse/Mouse ads-AP
MBS675119-01 1 mL

Goat Anti-Human IgG, Bovine/Horse/Mouse ads-AP

Sign In for Pricing
View Details
Goat Anti-Human IgG, Bovine/Horse/Mouse ads-AP
MBS675119-02 5x 1 mL

Goat Anti-Human IgG, Bovine/Horse/Mouse ads-AP

Sign In for Pricing
View Details
Prokaryotic Pig Plasminogen Activator, Urokinase
RPU61066-01 50 µg

Prokaryotic Pig Plasminogen Activator, Urokinase

Sign In for Pricing
View Details