Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM156, Human (HEK293, His)

TMEM156 Protein is a member of transmembrane proteins (TMEM) family. The expression levels of TMEM156 correlates with patient survival. TMEM156 is upregulated in tumor tissue. Many genes positively correlated with TMEM156 are involved in multiple immunological processes. Furthermore, genes negatively correlated with TMEM156 are linked with RHO GTPase effectors, which results in a poorer response to receptor activation, thus reducing cancer cell proliferation, survival, and migration. TMEM156 Protein, Human (HEK293, His) is the recombinant human-derived TMEM156 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMEM156 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmem156-protein-human-hek293-his.html

Purity

95.30

Smiles

KTPKERTLELSCLEVCLQSNFTYSLSSLNFSFVTFLQPVRETQIIMRIFLNPSNFRNFTRTCQDITGEFKMCSSCLVCEPKGNMDFISQEQTSKVLIRRGSMEVKANDFHSPCQHFNFSVAPLVDHLEEYNTTCHLKNHTGRSTIMEDEPSKEKSINYTCRIMEYPNDCIHISLHLEMDIKNITCS

Molecular Formula

80008 (Gene_ID) AAH30803.1 (K26-S211) (Accession)

Molecular Weight

Approximately 35-55 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Melanoma antigen family D, 2
323607 100 µL

Melanoma antigen family D, 2

Sign In for Pricing
View Details
Anti-Peripherin (Mouse Monoclonal) Antibody
MBS415075-01 0.1 mg

Anti-Peripherin (Mouse Monoclonal) Antibody

Sign In for Pricing
View Details
Anti-Peripherin (Mouse Monoclonal) Antibody
MBS415075-02 5x 0.1 mg

Anti-Peripherin (Mouse Monoclonal) Antibody

Sign In for Pricing
View Details
IGF1 Receptor (Phospho Tyr1166) (16G4) Rabbit Monoclonal Antibody
E28G2045 100 µL

IGF1 Receptor (Phospho Tyr1166) (16G4) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Benzoyl Peroxide 98% Extrapure Moisten with 25% Water
00391 00500 500 g

Benzoyl Peroxide 98% Extrapure Moisten with 25% Water

Sign In for Pricing
View Details
CD11b Rabbit monoclonal antibody
E43S40029 100 µL

CD11b Rabbit monoclonal antibody

Sign In for Pricing
View Details