Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM156, Human (HEK293, His)

TMEM156 Protein is a member of transmembrane proteins (TMEM) family. The expression levels of TMEM156 correlates with patient survival. TMEM156 is upregulated in tumor tissue. Many genes positively correlated with TMEM156 are involved in multiple immunological processes. Furthermore, genes negatively correlated with TMEM156 are linked with RHO GTPase effectors, which results in a poorer response to receptor activation, thus reducing cancer cell proliferation, survival, and migration. TMEM156 Protein, Human (HEK293, His) is the recombinant human-derived TMEM156 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMEM156 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmem156-protein-human-hek293-his.html

Purity

95.30

Smiles

KTPKERTLELSCLEVCLQSNFTYSLSSLNFSFVTFLQPVRETQIIMRIFLNPSNFRNFTRTCQDITGEFKMCSSCLVCEPKGNMDFISQEQTSKVLIRRGSMEVKANDFHSPCQHFNFSVAPLVDHLEEYNTTCHLKNHTGRSTIMEDEPSKEKSINYTCRIMEYPNDCIHISLHLEMDIKNITCS

Molecular Formula

80008 (Gene_ID) AAH30803.1 (K26-S211) (Accession)

Molecular Weight

Approximately 35-55 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAAP Double Nickase Plasmid (m)
sc-426972-NIC 20 µg

GAAP Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Rabbit Monoclonal CD21 Antibody (CR2/8769R) [Alexa Fluor 532]
NBP3-21135AF532 0.1 mL

Rabbit Monoclonal CD21 Antibody (CR2/8769R) [Alexa Fluor 532]

Sign In for Pricing
View Details
Rabbit Polyclonal YL1 Antibody [DyLight 350]
NBP1-71870UV 0.1 mL

Rabbit Polyclonal YL1 Antibody [DyLight 350]

Sign In for Pricing
View Details
Cyp4f17 (NM_001101445) Mouse Tagged ORF Clone Lentiviral Particle
MR214056L3V 200 µL

Cyp4f17 (NM_001101445) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Internal Ctrl Lentivirus
LTV-0002-4SIC 2x10^6

Internal Ctrl Lentivirus

Sign In for Pricing
View Details
Anti-PDHA2 antibody
STJ111984 100 µl

Anti-PDHA2 antibody

Sign In for Pricing
View Details