Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM156, Human (HEK293, His)

TMEM156 Protein is a member of transmembrane proteins (TMEM) family. The expression levels of TMEM156 correlates with patient survival. TMEM156 is upregulated in tumor tissue. Many genes positively correlated with TMEM156 are involved in multiple immunological processes. Furthermore, genes negatively correlated with TMEM156 are linked with RHO GTPase effectors, which results in a poorer response to receptor activation, thus reducing cancer cell proliferation, survival, and migration. TMEM156 Protein, Human (HEK293, His) is the recombinant human-derived TMEM156 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMEM156 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmem156-protein-human-hek293-his.html

Purity

95.30

Smiles

KTPKERTLELSCLEVCLQSNFTYSLSSLNFSFVTFLQPVRETQIIMRIFLNPSNFRNFTRTCQDITGEFKMCSSCLVCEPKGNMDFISQEQTSKVLIRRGSMEVKANDFHSPCQHFNFSVAPLVDHLEEYNTTCHLKNHTGRSTIMEDEPSKEKSINYTCRIMEYPNDCIHISLHLEMDIKNITCS

Molecular Formula

80008 (Gene_ID) AAH30803.1 (K26-S211) (Accession)

Molecular Weight

Approximately 35-55 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCEA2 (Transcription Elongation Factor A Protein 2, Testis-specific S-II, Transcription Elongation Factor S-II Protein 2, Transcription Elongation Factor TFIIS.l) (MaxLight 490)
MBS6396154-01 0.1 mL

TCEA2 (Transcription Elongation Factor A Protein 2, Testis-specific S-II, Transcription Elongation Factor S-II Protein 2, Transcription Elongation Factor TFIIS.l) (MaxLight 490)

Sign In for Pricing
View Details
TCEA2 (Transcription Elongation Factor A Protein 2, Testis-specific S-II, Transcription Elongation Factor S-II Protein 2, Transcription Elongation Factor TFIIS.l) (MaxLight 490)
MBS6396154-02 5x 0.1 mL

TCEA2 (Transcription Elongation Factor A Protein 2, Testis-specific S-II, Transcription Elongation Factor S-II Protein 2, Transcription Elongation Factor TFIIS.l) (MaxLight 490)

Sign In for Pricing
View Details
ZBTB17 Antibody
E30AC2452 100 µL

ZBTB17 Antibody

Sign In for Pricing
View Details
TXNDC4, Recombinant, Human, aa30-406, His-Tag (Endoplasmic Reticulum Resident Protein 44, ER Protein 44, Thioredoxin Domain-containing Protein 4, KIAA0573, ERP44, UNQ532/PRO1075)
T5010-11K-01 100 µg

TXNDC4, Recombinant, Human, aa30-406, His-Tag (Endoplasmic Reticulum Resident Protein 44, ER Protein 44, Thioredoxin Domain-containing Protein 4, KIAA0573, ERP44, UNQ532/PRO1075)

Sign In for Pricing
View Details
TXNDC4, Recombinant, Human, aa30-406, His-Tag (Endoplasmic Reticulum Resident Protein 44, ER Protein 44, Thioredoxin Domain-containing Protein 4, KIAA0573, ERP44, UNQ532/PRO1075)
T5010-11K-02 500 µg

TXNDC4, Recombinant, Human, aa30-406, His-Tag (Endoplasmic Reticulum Resident Protein 44, ER Protein 44, Thioredoxin Domain-containing Protein 4, KIAA0573, ERP44, UNQ532/PRO1075)

Sign In for Pricing
View Details
Ro 23-7014
HY-P2592 1 Each

Ro 23-7014

Sign In for Pricing
View Details