Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM156, Human (HEK293, His)

TMEM156 Protein is a member of transmembrane proteins (TMEM) family. The expression levels of TMEM156 correlates with patient survival. TMEM156 is upregulated in tumor tissue. Many genes positively correlated with TMEM156 are involved in multiple immunological processes. Furthermore, genes negatively correlated with TMEM156 are linked with RHO GTPase effectors, which results in a poorer response to receptor activation, thus reducing cancer cell proliferation, survival, and migration. TMEM156 Protein, Human (HEK293, His) is the recombinant human-derived TMEM156 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMEM156 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmem156-protein-human-hek293-his.html

Purity

95.30

Smiles

KTPKERTLELSCLEVCLQSNFTYSLSSLNFSFVTFLQPVRETQIIMRIFLNPSNFRNFTRTCQDITGEFKMCSSCLVCEPKGNMDFISQEQTSKVLIRRGSMEVKANDFHSPCQHFNFSVAPLVDHLEEYNTTCHLKNHTGRSTIMEDEPSKEKSINYTCRIMEYPNDCIHISLHLEMDIKNITCS

Molecular Formula

80008 (Gene_ID) AAH30803.1 (K26-S211) (Accession)

Molecular Weight

Approximately 35-55 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MST1/STK4 Antibody (07) [DyLight 550]
NBP3-06389R 0.1 mL

Mouse Monoclonal MST1/STK4 Antibody (07) [DyLight 550]

Sign In for Pricing
View Details
GLS-IN-968
562397 5.0mg

GLS-IN-968

Sign In for Pricing
View Details
Catalase (CAT) Antibody
abx111432 100 µL

Catalase (CAT) Antibody

Sign In for Pricing
View Details
Lentiviral human C8orf34 shRNA (UAS) - Lentiviral human C8orf34 shRNA (UAS, iRFP) (100)
GTR15098307 1 Vial

Lentiviral human C8orf34 shRNA (UAS) - Lentiviral human C8orf34 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Myo7a (NM_008663) Mouse Tagged ORF Clone
MG226682 10 µg

Myo7a (NM_008663) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal p53 DINP1 Antibody [DyLight 594]
NBP1-76638DL594 0.1 mL

Rabbit Polyclonal p53 DINP1 Antibody [DyLight 594]

Sign In for Pricing
View Details