Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM156, Human (HEK293, His)

TMEM156 Protein is a member of transmembrane proteins (TMEM) family. The expression levels of TMEM156 correlates with patient survival. TMEM156 is upregulated in tumor tissue. Many genes positively correlated with TMEM156 are involved in multiple immunological processes. Furthermore, genes negatively correlated with TMEM156 are linked with RHO GTPase effectors, which results in a poorer response to receptor activation, thus reducing cancer cell proliferation, survival, and migration. TMEM156 Protein, Human (HEK293, His) is the recombinant human-derived TMEM156 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMEM156 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmem156-protein-human-hek293-his.html

Purity

95.30

Smiles

KTPKERTLELSCLEVCLQSNFTYSLSSLNFSFVTFLQPVRETQIIMRIFLNPSNFRNFTRTCQDITGEFKMCSSCLVCEPKGNMDFISQEQTSKVLIRRGSMEVKANDFHSPCQHFNFSVAPLVDHLEEYNTTCHLKNHTGRSTIMEDEPSKEKSINYTCRIMEYPNDCIHISLHLEMDIKNITCS

Molecular Formula

80008 (Gene_ID) AAH30803.1 (K26-S211) (Accession)

Molecular Weight

Approximately 35-55 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anp32a Mouse qPCR Primer Pair (NM_009672)
MP200207 200 Reactions

Anp32a Mouse qPCR Primer Pair (NM_009672)

Sign In for Pricing
View Details
ASF1B (ASF1 anti-silencing function 1 Homolog B (S. cerevisiae), CIA-II, FLJ10604) (MaxLight 490)
243545-ML490 100 µL

ASF1B (ASF1 anti-silencing function 1 Homolog B (S. cerevisiae), CIA-II, FLJ10604) (MaxLight 490)

Sign In for Pricing
View Details
Human ALK-1 Recombinant Protein
PROTP37023-250ug 250 µg

Human ALK-1 Recombinant Protein

Sign In for Pricing
View Details
Mouse Scaffold attachment factor B2, Safb2 ELISA KIT
ELI-35919m 96 Tests

Mouse Scaffold attachment factor B2, Safb2 ELISA KIT

Sign In for Pricing
View Details
CARD11 (NM_032415) Human Tagged ORF Clone Lentiviral Particle
RC222740L3V 200 µL

CARD11 (NM_032415) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Danio rerio Mitochondrial translocator assembly and maintenance protein 41 homolog (tamm41)
MBS1414623-01 0.02 mg (E-Coli)

Recombinant Danio rerio Mitochondrial translocator assembly and maintenance protein 41 homolog (tamm41)

Sign In for Pricing
View Details