Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Human

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and recruits caspase-8 through FADD to initiate cell apoptosis. It forms the death-inducing signaling complex (DISC), activates caspases and mediates apoptosis. TRAIL R2/TNFRSF10B Protein, Human is the recombinant human-derived TRAIL R2/TNFRSF10B protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-r2-tnfrsf10b-protein-human.html

Purity

97.00

Smiles

ESALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKES

Molecular Formula

8795 (Gene_ID) O14763 (E52-S183) (Accession)

Molecular Weight

Approximately 14.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Cortisol ELISA Kit
orb339851-01 24 Tests

Goat Cortisol ELISA Kit

Sign In for Pricing
View Details
Goat Cortisol ELISA Kit
orb339851-02 48 Tests

Goat Cortisol ELISA Kit

Sign In for Pricing
View Details
Goat Cortisol ELISA Kit
orb339851-03 96 Tests

Goat Cortisol ELISA Kit

Sign In for Pricing
View Details
Goat Cortisol ELISA Kit
orb339851-04 5 x 96 T

Goat Cortisol ELISA Kit

Sign In for Pricing
View Details
Goat Cortisol ELISA Kit
orb339851-05 10 x 96 T

Goat Cortisol ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal ACD Antibody (OTI2B1) [DyLight 550]
NBP2-72169R 0.1 mL

Mouse Monoclonal ACD Antibody (OTI2B1) [DyLight 550]

Sign In for Pricing
View Details