Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leu-Enkephalin - Fluorescent EIA Kit

Product Specifications

CAS Number

9000-83-3

Shipping Conditions

All RIA kits, Tracers, and CE-MARKED kits are shipped on blue ice to ensure optimal stability and performance during transport with a single 10 euro charge per shipment for the blue ice. All other products are shipped in standard packaging, as they remain fully stable under these conditions.

Storage Conditions

Lyophilized peptides should be stored at +4°C. After rehydration, aliquot the solution and freeze at -20°C to -80°C. Rehydrated, frozen peptides are typically stable for 3 months. Please avoid multiple freeze-thaw cycles. Upon receipt, please store EIA Kits in the fridge at +4°C. Do not freeze the kits. RIA Kits should be Frozen at -20°C upon reciept. We ship our I-125 tracers on dry ice. Upon receipt, please keep these stored at -20°C in its lyophilized form until it is ready to be used. Once rehydrated, please store at +4°C for up to one week. Due to its half-life, we recommend that the kit be used as soona s possible upon receipt.

Package Size

The standard packaging options include four types : -Type A (Vials) with a volume weight of 1 kg and dimensions of 16 x 12 x 12 cm -Type B (1 Kit/Vials) weighing 1.5 kg with dimensions of 21 x 16 x 16 cm -Type C (2–4 Kits) weighing 2.5 kg at 31 x 23 x 17 cm -Type D (5–9 Kits) weighing 5 kg at 35 x 25 x 26 cm. For shipments requiring blue ice, the packaging options include : -Type A (1 Kit/Tracer) with a volume weight of 3 kg and dimensions of 33 x 20 x 18.5 cm -Type B (2–3 Kits) weighing 4.5 kg and measuring 40 x 29 x 18 cm -Type C (4–12 Kits) weighing 14 kg with dimensions of 58 x 38.5 x 30 cm. Additionally, large packaging is available for bulk orders and is tailored to specific requirements, typically with volume weights of 13 kg or 23kg.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ORMDL1 qPCR Primer Pair
QH59041S 200 Tests

Human ORMDL1 qPCR Primer Pair

Sign In for Pricing
View Details
Lentiviral mouse Hhla1 shRNA (UAS) - Lentiviral mouse Hhla1 shRNA (UAS, iRFP) (100)
GTR15295218 1 Vial

Lentiviral mouse Hhla1 shRNA (UAS) - Lentiviral mouse Hhla1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
HY-P3431 1 Each

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
Chloramphenicol Rabbit Polyclonal Antibody (HRP)
orb481413 100 µL

Chloramphenicol Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
VILIP1, CT (Visinin-like Protein 1, VILIP, VLP-1, VSNL1, VISL1, Hippocalcin-like Protein 3, HLP3) (APC) discontinued
V2124-26D-APC 200 µL

VILIP1, CT (Visinin-like Protein 1, VILIP, VLP-1, VSNL1, VISL1, Hippocalcin-like Protein 3, HLP3) (APC) discontinued

Sign In for Pricing
View Details
GRB2 (Growth Factor Receptor-Bound Protein 2, ASH, Abundant Src Homology, Grb3-3, MST084, NCKAP2, MSTP084, EGFRBP-GRB2) (HRP)
MBS6419163-01 0.1 mL

GRB2 (Growth Factor Receptor-Bound Protein 2, ASH, Abundant Src Homology, Grb3-3, MST084, NCKAP2, MSTP084, EGFRBP-GRB2) (HRP)

Sign In for Pricing
View Details