Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solanum tuberosum Snakin-1 (SN1)

Product Specifications

Abbreviation

Recombinant Solanum tuberosum SN1 protein

Gene Name

SN1

UniProt

Q948Z4

Expression Region

26-88aa

Organism

Solanum tuberosum (Potato)

Target Sequence

GSSFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCP

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Has an antimicrobial activity. Causes a rapid aggregation of both Gram-positive and Gram-negative bacteria, but the antimicrobial activity is not correlated with the capacity to aggregate bacteria.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

8.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Rtl6 Pre-designed siRNA Set B
SI212300B 1 Each

Rat Rtl6 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Salmonella ubiB Protein (aa 1-546) (strain P125109)
VAng-Wyb0657-inquire Inquire

Recombinant Salmonella ubiB Protein (aa 1-546) (strain P125109)

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor A
550594 200 µL

Vascular Endothelial Growth Factor A

Sign In for Pricing
View Details
Anti-HMGB2  (3E5)
YF-MA10431 100 ug

Anti-HMGB2 (3E5)

Sign In for Pricing
View Details
Insc sgRNA CRISPR Lentivector set (Mouse)
K4222501 3x 1.0 µg

Insc sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
APOC2 (Apolipoprotein C-II, Apo-CII, ApoC-II, APC2, Apolipoprotein C2) (MaxLight 405)
MBS6188891-01 0.1 mL

APOC2 (Apolipoprotein C-II, Apo-CII, ApoC-II, APC2, Apolipoprotein C2) (MaxLight 405)

Sign In for Pricing
View Details