Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP IL-3, Human (His)

IL-3 protein is mainly secreted by T lymphocytes, mast cells and osteoblasts and is critical for the generation and differentiation of hematopoietic progenitor cells. It stimulates mature basophils, eosinophils and monocytes, promoting functional activation. GMP IL-3 Protein, Human (His) is the recombinant human-derived IL-3 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GMP IL-3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-il-3-protein-human.html

Purity

95.20

Smiles

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Molecular Formula

3562 (Gene_ID) P08700 (A20-F152) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTMR9 Rabbit Polyclonal Antibody
TA378763 100 µL

MTMR9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LYVE1 Rabbit Polyclonal Antibody
TA378182 100 µL

LYVE1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS624356 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Ccdc126 Mouse Gene Knockout Kit (CRISPR)
KN502649 1 Kit

Ccdc126 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SYT2 (NM_001136504) Human Over-expression Lysate
LC427901 20 µg

SYT2 (NM_001136504) Human Over-expression Lysate

Sign In for Pricing
View Details
NebuLette (NEBL) (NM_213569) Human Recombinant Protein
TP312733L 1 mg

NebuLette (NEBL) (NM_213569) Human Recombinant Protein

Sign In for Pricing
View Details