Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP IL-3, Human (His)

IL-3 protein is mainly secreted by T lymphocytes, mast cells and osteoblasts and is critical for the generation and differentiation of hematopoietic progenitor cells. It stimulates mature basophils, eosinophils and monocytes, promoting functional activation. GMP IL-3 Protein, Human (His) is the recombinant human-derived IL-3 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GMP IL-3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-il-3-protein-human.html

Purity

95.20

Smiles

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Molecular Formula

3562 (Gene_ID) P08700 (A20-F152) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cubilin (CUBN) Antibody (FITC)
abx274293-01 200 µL

Cubilin (CUBN) Antibody (FITC)

Sign In for Pricing
View Details
Cubilin (CUBN) Antibody (FITC)
abx274293-02 1 mL

Cubilin (CUBN) Antibody (FITC)

Sign In for Pricing
View Details
Anti-HNF4  (1H2)
YF-MA13506 100 ug

Anti-HNF4 (1H2)

Sign In for Pricing
View Details
Mpv17l sgRNA CRISPR Lentivector (Rat) (Target 1)
K6566502 1.0 µg DNA

Mpv17l sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Mouse Anti-Human IgA antibody
STJ99556-100l 100 µl

Mouse Anti-Human IgA antibody

Sign In for Pricing
View Details
Lentiviral mouse Necap1 shRNA (UAS) - Lentiviral mouse Necap1 shRNA (UAS, iRFP) (25)
GTR15283406 1 Vial

Lentiviral mouse Necap1 shRNA (UAS) - Lentiviral mouse Necap1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details