Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Mouse (HEK293, His-Fc)

PD-1 (programmed cell death 1) protein negatively regulates immune responses and affects processes such as apoptosis and tolerance induction. It is a transmembrane protein found on the outside of the plasma membrane and expressed in the retina. PD-1 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived PD-1 protein, expressed by HEK293 , with C-hFc, C-8*His labeled tag.

Product Specifications

Product Name Alternative

PD-1 Protein, Mouse (HEK293, His-Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-mouse-hek293-his-fc.html

Purity

95.0

Smiles

LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ

Molecular Formula

18566 (Gene_ID) NP_032824.1 (L25-Q167) (Accession)

Molecular Weight

60-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-100 1x 100 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-100 1x 100 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF640R conjugate, 0.1mg/mL
BNC400032-500 1x 500 µL

MUC2 (CCP58), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
BNC940149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-100 1x 100 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Moesin (MSN/492), CF568 conjugate, 0.1mg/mL
BNC680492-100 1x 100 µL

Moesin (MSN/492), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details